close all open/close all

CDS information : Meili_00190


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction33,753 / 35,426 / + [in whole cluster]
33,753 / 35,426 / + [in contig]
Location33753..35426 [in whole cluster]
33753..35426 [in contig]
TypeCDS
Length1,674 bp (557 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)two-component system histidine kinase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf17

close this sectionSequence

selected fasta
>[two-component system histidine kinase]
MVAAFRRQTLAGEMLVLQLAIVVVVLLAVAAVSLAQSEATFNRVEGRRVSALAEQLAAHP
LVHSRLVKPAPAEALAPLVHSTQVQSDVTSVTVADRAGRVVSSTNPTVVGDRLPLGEGVG
AGRGWSGSLAWDGNRELVAQVPVLGTTGDDVGRRLGTVMVGEASPTVWQRLSGASSYLLI
YLGVASALGVVGSWLLARRVKRQTLGLEPREITGLAEHREAMLYGIAEGVVALDPQHRLT
LVNDVGRRLLDLPVDSVGRTVAELGIDGRLLDVLTGAQDTTADARDEVVVRHGRVLVMNR
MTVTKDGRLLGSVATLRDRTELAHLEREIGSFRSTSELLRAQAHEFANQLHTISGLIQIG
EQEEVVRYIRALNQRRQSLDMTVGRRVRDTAVAALLMAKSAQAAERKVALRISDRTGLGR
LAPEDAADVATVVGNLVDNAIDAATAGEPDGSLHGGVPYDEAWVEVELRQDAASVEIVVR
DSGPGVAPELAQEVFAHGFTTKAAQEGERGIGLALTRLVCERRGGEIAVTNTAEGAMFTA
RMSVGHPTGAAAEGATP
selected fasta
>[two-component system histidine kinase]
GTGGTCGCCGCGTTCCGTCGCCAAACGCTCGCGGGCGAGATGCTGGTACTCCAGCTCGCC
ATCGTCGTGGTGGTGCTGCTGGCGGTCGCCGCGGTCTCGCTCGCACAGTCGGAGGCCACC
TTCAACCGGGTCGAAGGACGGCGGGTGAGCGCGCTGGCCGAGCAGCTGGCCGCCCACCCT
CTCGTACACAGTCGGCTGGTGAAACCCGCGCCCGCCGAGGCCCTGGCCCCTTTGGTGCAC
TCCACACAGGTGCAGTCCGATGTCACCTCGGTGACAGTGGCCGACCGCGCCGGCCGCGTC
GTCAGCTCGACCAATCCCACGGTGGTCGGCGACCGGCTGCCGCTGGGCGAGGGGGTCGGC
GCGGGCCGGGGCTGGTCCGGCTCGCTGGCCTGGGACGGCAACCGGGAGCTGGTGGCCCAG
GTGCCGGTGCTCGGCACGACGGGGGACGACGTGGGCCGGAGGCTGGGCACGGTCATGGTC
GGCGAGGCGTCCCCGACGGTGTGGCAGCGGCTCAGCGGCGCCTCCTCGTATCTGCTGATC
TACCTCGGCGTCGCCAGTGCGCTCGGCGTCGTCGGCTCCTGGCTGCTCGCCCGGCGCGTG
AAACGCCAGACGCTCGGACTGGAGCCACGCGAGATCACCGGACTGGCCGAGCACCGCGAG
GCCATGCTGTACGGGATCGCCGAGGGCGTCGTCGCCCTGGACCCACAGCACCGCCTCACC
CTCGTCAACGACGTGGGCAGGCGGCTGCTCGACCTGCCCGTGGACAGCGTCGGCCGGACC
GTGGCCGAGCTCGGCATCGACGGACGGCTGCTCGACGTGCTGACCGGGGCGCAGGACACC
ACCGCGGACGCGCGTGACGAGGTCGTCGTCCGCCACGGCCGCGTCCTGGTCATGAACCGG
ATGACGGTCACCAAGGACGGCCGGCTGCTCGGCTCCGTCGCCACCCTGCGCGACCGCACC
GAACTGGCCCACCTGGAGCGCGAAATCGGCTCCTTCCGCAGCACCTCCGAGCTGCTGCGC
GCCCAGGCGCACGAGTTCGCCAACCAGCTGCACACCATCTCCGGGCTGATCCAGATCGGC
GAGCAGGAGGAGGTGGTGCGCTACATCCGCGCATTGAACCAGCGCCGCCAGTCACTCGAC
ATGACCGTCGGCCGCCGGGTCCGCGACACCGCCGTCGCCGCGCTGCTGATGGCGAAGTCC
GCCCAGGCCGCCGAGCGGAAGGTCGCCCTGCGCATCTCCGACCGTACGGGTCTTGGCCGC
CTCGCCCCGGAAGACGCCGCCGACGTGGCGACCGTGGTCGGCAACCTCGTCGACAACGCC
ATCGACGCGGCCACCGCGGGCGAGCCCGACGGCTCGCTCCACGGCGGCGTCCCGTATGAC
GAGGCGTGGGTGGAGGTCGAACTGCGACAGGACGCCGCCAGCGTGGAGATCGTGGTACGC
GACTCGGGCCCCGGCGTCGCCCCCGAACTCGCCCAAGAAGTCTTCGCACACGGCTTCACC
ACCAAGGCCGCCCAAGAGGGCGAGCGCGGCATCGGGCTCGCCCTGACCCGTCTCGTCTGC
GAGCGCCGCGGCGGAGAGATCGCGGTCACCAATACGGCCGAGGGCGCCATGTTCACCGCG
CGCATGTCCGTCGGCCACCCCACCGGCGCGGCGGCGGAAGGAGCTACCCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000014 PAS domain (Domain)
 [217-282]  0.000689999963379701 SM00091
SM00091   PAS
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [424-546]  3.80000697093586e-20 SM00387
SM00387   HATPase_c
 [392-544]  7.29999999999998e-24 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
 [377-542]  8.5999877623955e-23 SSF55874
SSF55874   ATP_bd_ATPase
 [425-542]  8.10000000000001e-19 PF02518
PF02518   HATPase_c
IPR004358 Signal transduction histidine kinase-related protein, C-terminal (Domain)
 [475-489]  1.19999985703101e-06 PR00344 [507-525]  1.19999985703101e-06 PR00344 [530-543]  1.19999985703101e-06 PR00344
PR00344   BCTRLSENSOR
IPR005467 Signal transduction histidine kinase, core (Domain)
 [341-546]  PS50109
PS50109   HIS_KIN
IPR016120 Signal transduction histidine kinase, sporulation regulator SpoOB (Domain)
 [327-377]  6.59999852526375e-11 SSF55890
SSF55890   Sensor_kinase_SpoOB-type
IPR016121 Sporulation regulator, sensor kinase SpoOB-type, helix hairpin (Domain)
 [323-378]  1.3e-18 G3DSA:1.10.287.130
G3DSA:1.10.287.130   Sensor_kinase_SpoOB-type_hlx
SignalP
 [1-35]  0.943 Signal
Eukaryota   
 [1-35]  0.874 Signal
Bacteria, Gram-negative   
 [1-37]  0.985 Signal
Bacteria, Gram-positive   
TMHMM
 [15-34]  Transmembrane (o-i) [175-197]  Transmembrane (i-o)
Transmembrane 2