close all open/close all

CDS information : Meili_00200


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction35,423 / 36,115 / + [in whole cluster]
35,423 / 36,115 / + [in contig]
Location35423..36115 [in whole cluster]
35423..36115 [in contig]
TypeCDS
Length693 bp (230 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)two-component system response regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf18

close this sectionSequence

selected fasta
>[two-component system response regulator]
MTEPTGTIDVLVVDDDFMVARVHRTFVERVPSFRVVGTAHTGEQAIKAVDELRPDLVLLD
LYLPDVFGLDVIPRLRTAGHDCDVLVISAAREADAVRDAVRHGVVDYLLKPFDYEDLQPR
LERYATRRGRLLTTVVRGQADVDRALAGAFAPAAGNALPKGMSVETADLIERALRDADGT
LSATEAATATGVSRVSARRYLEYFHDTGHADVALRYGSAGRPERRYSWRA
selected fasta
>[two-component system response regulator]
ATGACCGAGCCGACCGGCACCATCGACGTCCTGGTCGTCGACGACGACTTCATGGTCGCC
CGGGTCCACCGCACGTTTGTCGAACGAGTCCCCTCCTTCCGGGTCGTCGGCACCGCTCAC
ACCGGCGAGCAGGCCATCAAGGCCGTGGACGAGCTGCGCCCCGACCTCGTCCTGCTCGAC
CTGTACCTGCCGGATGTCTTCGGCCTCGATGTCATCCCCCGGCTGCGCACCGCCGGACAC
GACTGCGACGTGCTGGTCATCAGCGCGGCCCGCGAGGCCGACGCGGTGCGCGACGCCGTA
CGCCACGGCGTCGTCGACTACCTCCTCAAGCCCTTCGACTACGAGGACCTGCAGCCCCGC
CTCGAACGGTACGCGACCCGGCGCGGGCGTCTGCTCACCACCGTCGTCCGCGGCCAGGCG
GACGTGGACCGCGCCCTGGCCGGGGCCTTCGCGCCCGCGGCGGGCAACGCCCTGCCGAAG
GGCATGAGCGTGGAGACCGCCGACCTGATCGAGCGGGCGCTCCGGGACGCGGACGGCACC
CTCTCCGCCACCGAAGCGGCGACCGCCACCGGCGTCTCCAGGGTGAGCGCCCGCCGCTAC
CTGGAGTACTTCCACGACACCGGCCACGCCGATGTGGCACTGCGCTACGGCAGCGCCGGC
CGGCCGGAGCGCCGGTACAGCTGGCGGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [10-120]  1.4e-22 PF00072
PF00072   Response_reg
 [8-121]  3.00000067992871e-29 SM00448
SM00448   REC
 [9-125]  PS50110
PS50110   RESPONSE_REGULATORY
IPR011006 CheY-like superfamily (Domain)
 [5-200]  3.70001063537244e-33 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [172-210]  0.00038 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR024187 Signal transduction response regulator, citrate/malate metabolism (Family)
 [1-230]  5.79999653854781e-106 PIRSF006171
PIRSF006171   RR_citrat_malat
SignalP No significant hit
TMHMM No significant hit