close all open/close all

CDS information : Meili_00210


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction37,263 / 36,139 / - [in whole cluster]
37,263 / 36,139 / - [in contig]
Locationcomplement(36139..37263) [in whole cluster]
complement(36139..37263) [in contig]
TypeCDS
Length1,125 bp (374 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf19

close this sectionSequence

selected fasta
>[hypothetical protein]
MGDATRHTLRGFAEVLVRLGIATEEQAAVGLAEAAGIGMDLDEDFDNPDELTFLVGECGL
GFQTPEKVLGYLEDGYEELLVDAAACAGGSVVVDDVELVKDADGEEYLHFRRNGRSIWHP
AEHLSDSTRYMDWNTAFDAIGDLVPGNDDPRGFYQLDEDSYDAWWLLLTPEQAKGLEEFG
LPLPVDLGNWVRDKMPTAEPGTLAWYMEDDRLHASEESRRCLDEWLAPMDAALDRWRTVH
LPDDFPFDYSPDSLLVLERLVLDRFDGPASLEVAAGAGDEFYAGAVRYVGETALRMWPCR
WTYRHSDDPLMVFTNEPMICPNAPRNFAWDVSPRYALHTLVQDRTPHSLREYLSTVADAV
DSYHKALRARTRGR
selected fasta
>[hypothetical protein]
ATGGGCGACGCAACACGACACACGCTCCGTGGATTCGCGGAGGTCCTGGTCCGGCTGGGC
ATAGCGACGGAGGAGCAGGCCGCTGTCGGTCTGGCGGAAGCCGCCGGGATCGGCATGGAC
CTTGATGAGGACTTCGACAACCCCGACGAGCTGACCTTCCTCGTCGGCGAATGCGGCCTC
GGCTTCCAGACACCCGAAAAGGTACTGGGCTACCTTGAGGACGGATACGAGGAGTTGCTG
GTCGACGCGGCGGCGTGCGCGGGCGGCTCGGTGGTGGTCGACGATGTCGAGCTGGTGAAG
GATGCGGACGGAGAGGAGTATCTGCACTTCCGGCGCAATGGCCGGTCGATTTGGCACCCG
GCGGAACACCTCTCCGACAGCACGCGCTACATGGACTGGAACACCGCCTTCGACGCCATA
GGCGACCTCGTGCCCGGCAACGACGATCCACGGGGTTTTTACCAGCTGGACGAGGATTCC
TATGACGCCTGGTGGCTTCTGCTCACGCCCGAACAGGCCAAGGGCCTGGAGGAGTTCGGT
CTGCCGTTGCCGGTGGATCTCGGCAATTGGGTGCGTGACAAGATGCCCACAGCGGAACCC
GGCACGCTCGCGTGGTACATGGAGGACGACCGCCTGCACGCCAGTGAGGAGTCCCGCCGG
TGTCTTGACGAGTGGCTGGCCCCCATGGACGCCGCACTGGACCGGTGGCGTACGGTCCAT
CTGCCGGATGACTTCCCCTTCGACTACTCACCGGACTCGCTCTTGGTGCTGGAACGGCTT
GTGCTGGACCGTTTCGACGGCCCCGCCTCGCTGGAGGTTGCGGCCGGTGCCGGAGACGAG
TTCTACGCGGGCGCGGTGCGGTACGTGGGTGAGACCGCGCTGCGGATGTGGCCGTGCCGT
TGGACGTACCGGCACTCCGACGACCCTTTGATGGTGTTCACCAACGAGCCGATGATCTGT
CCCAACGCCCCGAGGAATTTCGCGTGGGATGTATCTCCCCGTTACGCGCTGCACACCCTC
GTACAAGACCGTACGCCTCATAGCCTGCGGGAGTACCTGAGCACGGTCGCGGATGCGGTC
GACAGTTACCACAAGGCGCTCCGCGCCCGCACCCGCGGTCGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-34]  0.238 Signal
Bacteria, Gram-positive   
TMHMM No significant hit