close all open/close all

CDS information : Meili_00220


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction37,849 / 37,274 / - [in whole cluster]
37,849 / 37,274 / - [in contig]
Locationcomplement(37274..37849) [in whole cluster]
complement(37274..37849) [in contig]
TypeCDS
Length576 bp (191 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)heavy metal translocating P-type ATPase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf20

close this sectionSequence

selected fasta
>[heavy metal translocating P-type ATPase]
MEDRTYPELLGIIDEFAGTLDPKEQVARLYDLMAPLHDRVAQESEEFSDEPVLTPADVVR
GFRQVAAGEPADVDAVYDHLTAMGLYYCEDQDPERHVVSQTAFAAAVWLRLLTGRELHAT
SLDDDEDLVPPFAPSAFTQIIDLLAWTRSGQTYMFWGDALTNPDFCDFPAAVRELGAIHM
EITDSGRRKNG
selected fasta
>[heavy metal translocating P-type ATPase]
ATGGAAGACAGGACGTACCCCGAATTGCTGGGGATCATCGATGAGTTCGCCGGGACACTG
GACCCGAAGGAGCAGGTGGCCCGCCTTTACGACCTGATGGCTCCGTTGCACGACCGTGTT
GCGCAGGAGAGCGAGGAGTTCAGCGATGAGCCTGTGCTGACGCCCGCGGATGTGGTGCGC
GGGTTCCGTCAAGTTGCCGCCGGCGAACCGGCCGACGTTGATGCCGTCTATGACCATCTG
ACCGCCATGGGCCTGTACTACTGCGAGGATCAGGACCCGGAGCGGCATGTGGTGTCCCAG
ACGGCGTTCGCGGCGGCGGTCTGGCTGCGCCTGCTGACCGGGCGGGAGTTGCATGCGACA
AGCCTTGATGACGACGAGGATCTGGTCCCACCGTTCGCCCCCTCGGCGTTCACGCAGATC
ATCGACCTTCTGGCCTGGACGCGATCGGGCCAGACGTACATGTTCTGGGGGGATGCCCTC
ACCAATCCCGACTTCTGTGATTTTCCGGCCGCTGTACGCGAGCTCGGGGCGATACACATG
GAGATCACGGACTCAGGGCGTCGGAAGAATGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit