close all open/close all

CDS information : Meili_00230


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction38,044 / 39,195 / + [in whole cluster]
38,044 / 39,195 / + [in contig]
Location38044..39195 [in whole cluster]
38044..39195 [in contig]
TypeCDS
Length1,152 bp (383 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf21

close this sectionSequence

selected fasta
>[hypothetical protein]
MRSRTLSRYSTVAATVLSATLLPLSAAHAADATADDSAPAATQTTIASFGRIADAVLTDR
TTALLDRPQLARTAQKSQGNVRLSPGASRAESTSLASVQDTRARLAALGEAYSDADTKTT
VDSTRVEGRKATVRVTEATTLTYEKIRGDEPPTTGFTAHHELTFTAQTDGTWQLVSVRRT
DKGPRPVNEPVPATKTAPVRPSAIIDAPRAATTYPAPAKPKNLGTGTAYNYAAMATYAEK
YWKDYNTAYRRFNSAGGDCTNYISQSLYAGGWKHDTTSTEDYDTWWYGTSSQSDTWVGVN
EWSWFTQTAKRTTALTNAYQMDLGDVLQVDFDKDGAKDHTMITSYRSTSGVPYLTYHDTD
TYRRSLSSLLSSYPNSAYYAYRT
selected fasta
>[hypothetical protein]
GTGAGATCTCGGACGTTGAGCCGTTACTCAACCGTGGCCGCGACCGTGCTGTCCGCCACA
CTGCTGCCCCTGTCCGCCGCCCACGCAGCCGATGCCACCGCCGACGACTCGGCGCCCGCG
GCGACGCAGACGACCATCGCGTCCTTCGGCCGAATAGCGGACGCCGTACTGACCGACCGC
ACCACCGCCCTGCTCGACCGGCCCCAACTCGCCCGCACGGCACAGAAGTCGCAGGGCAAC
GTGCGGCTCTCGCCCGGGGCCTCCCGCGCGGAGAGCACCAGCCTGGCCTCCGTGCAGGAC
ACGCGCGCCCGGCTGGCCGCGCTCGGCGAGGCCTACAGCGACGCCGACACGAAGACCACC
GTCGACAGCACCCGTGTGGAGGGTCGGAAGGCCACGGTCCGCGTCACCGAAGCCACCACC
CTCACCTACGAGAAGATCCGCGGCGACGAGCCCCCGACCACCGGCTTCACCGCACACCAC
GAACTCACCTTCACGGCACAGACGGACGGCACCTGGCAGCTGGTGAGCGTCCGCCGCACG
GACAAGGGCCCCCGCCCGGTCAACGAGCCCGTCCCGGCGACGAAGACGGCGCCGGTGCGC
CCGAGCGCCATCATCGACGCCCCCCGCGCCGCCACCACGTACCCGGCGCCGGCCAAGCCC
AAGAACCTCGGCACCGGCACCGCGTACAACTACGCGGCGATGGCGACATACGCCGAGAAG
TACTGGAAGGATTACAACACCGCCTACCGCCGTTTCAACAGCGCCGGCGGGGACTGCACC
AACTACATCAGCCAGTCTCTCTACGCAGGCGGCTGGAAACACGACACCACCTCCACCGAG
GACTACGACACCTGGTGGTACGGCACGTCGAGCCAGTCCGACACCTGGGTCGGCGTCAAC
GAGTGGTCCTGGTTCACGCAGACCGCGAAGCGGACCACCGCCCTCACGAACGCCTACCAG
ATGGACCTCGGTGACGTCCTTCAGGTGGACTTCGACAAGGACGGCGCCAAGGATCACACC
ATGATCACCTCGTACCGGAGCACGAGCGGCGTCCCGTACCTCACCTACCACGACACCGAC
ACCTACCGGCGGTCGCTGTCCAGCCTCCTCTCGTCGTACCCGAACTCCGCGTACTACGCC
TACCGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR024301 Putative amidase domain (Domain)
 [229-381]  1.70000000000001e-34 PF12671
PF12671   Amidase_6
SignalP
 [1-29]  1 Signal
Bacteria, Gram-negative   
 [1-29]  1 Signal
Bacteria, Gram-positive   
 [1-29]  0.999 Signal
Eukaryota   
TMHMM No significant hit