close all open/close all

CDS information : Meili_00250


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction57,429 / 58,421 / + [in whole cluster]
57,429 / 58,421 / + [in contig]
Location57429..58421 [in whole cluster]
57429..58421 [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)post-polyketide modification protein
Gene
Gene (GenBank)meiC
EC number
Keyword
  • spiroketal moiety
Note
Note (GenBank)
  • similar to AveC; MeiC
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)
[23294008] Spiroketal formation and modification in avermectin biosynthesis involves a dual activity of AveC. (J Am Chem Soc. , 2013)
Related Reference
ACC
Q9S0R6
NITE
Aver_00060
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[15721808] Semi-synthetic DNA shuffling of aveC leads to improved industrial scale production of doramectin by Streptomyces avermitilis. (Metab Eng. , 2005)
[18824353] Engineering of avermectin biosynthetic genes to improve production of ivermectin in Streptomyces avermitilis. (Bioorg Med Chem Lett. , 2008)
[23294008] Spiroketal formation and modification in avermectin biosynthesis involves a dual activity of AveC. (J Am Chem Soc. , 2013)

close this sectionSequence

selected fasta
>cyclase/dehydratase [post-polyketide modification protein]
MTDLVDEDRPEAVGRADTVRGLRVFTLPVTLWACVGALVLGLQVYVFAAWLADSGYRIEK
ASPARGGGDSERIADVLIPLLSVVGAVVLAVCLYRRCRARRRLTFDASLFIGLLSASWQS
PLMNWINPVLASNVNVFGAVASWGPYVPGWQGAGAHQEAELPLATLSICMTAMMAAVACG
KGMGLAAARWPRLGPLRLIALGFLLVVLLDIAEPLVSFAGVSVWTRAVPELTIWSGHWYQ
FPLYQMVASALFGASLGAARHFRNRRGETCLESGTALLPEGPRPWVRLLAVVGGANISIA
LYTGAHILFSLMDGAPPDRLPEFFRPAAGY
selected fasta
>cyclase/dehydratase [post-polyketide modification protein]
ATGACCGATCTCGTCGACGAAGACCGGCCGGAGGCCGTCGGCCGGGCCGATACCGTACGC
GGCCTGCGGGTGTTCACCCTTCCCGTAACACTGTGGGCGTGTGTCGGCGCGCTGGTGCTG
GGACTTCAGGTGTACGTGTTCGCCGCCTGGCTCGCCGACAGCGGCTACCGCATCGAGAAG
GCGTCCCCGGCCAGGGGCGGTGGGGACTCGGAGCGGATCGCCGATGTGCTGATCCCGCTG
CTGTCCGTGGTGGGAGCGGTGGTCCTCGCAGTGTGTCTGTACCGGAGGTGTCGGGCCAGG
AGGCGGCTGACGTTCGACGCGTCGCTCTTCATCGGGCTGCTGTCGGCCAGTTGGCAGAGT
CCCTTGATGAACTGGATCAATCCGGTGCTCGCGTCAAACGTCAATGTGTTCGGAGCGGTG
GCCTCGTGGGGGCCGTATGTGCCCGGTTGGCAGGGGGCGGGGGCGCACCAGGAGGCCGAG
CTGCCGCTGGCGACCCTGAGCATCTGTATGACGGCCATGATGGCCGCCGTGGCCTGCGGC
AAGGGCATGGGTCTTGCCGCCGCCCGGTGGCCGCGGCTGGGGCCGCTCCGGCTGATCGCG
CTCGGCTTTCTGCTCGTCGTGCTCCTCGACATCGCCGAGCCGCTGGTGTCCTTCGCGGGC
GTCTCCGTGTGGACGCGGGCAGTGCCCGAGCTGACCATCTGGAGTGGGCACTGGTATCAG
TTCCCGCTGTATCAGATGGTGGCTTCGGCGCTCTTCGGCGCCTCTTTGGGGGCCGCGCGC
CACTTTCGCAACCGGCGCGGCGAAACGTGTCTGGAGTCCGGGACGGCCCTCCTACCGGAG
GGCCCGAGGCCATGGGTCCGGCTGCTGGCGGTGGTGGGCGGGGCCAACATCAGCATCGCC
CTCTACACCGGCGCACACATCCTGTTCTCGCTGATGGACGGCGCTCCCCCGGACCGGCTC
CCCGAATTCTTCCGTCCGGCGGCCGGCTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-33]  0.344 Signal
Bacteria, Gram-positive   
 [1-37]  0.384 Signal
Eukaryota   
TMHMM
 [30-52]  Transmembrane (i-o) [72-94]  Transmembrane (o-i) [199-221]  Transmembrane (i-o) [236-258]  Transmembrane (o-i) [288-310]  Transmembrane (i-o)
Transmembrane 5