close all open/close all

CDS information : Meili_00260


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction59,859 / 58,480 / - [in whole cluster]
59,859 / 58,480 / - [in contig]
Locationcomplement(58480..59859) [in whole cluster]
complement(58480..59859) [in contig]
TypeCDS
Length1,380 bp (459 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)cytochrome P450 hydroxylase
Gene
Gene (GenBank)meiE
EC number
Keyword
  • furan ring
Note
Note (GenBank)
  • similar to AveE; MeiE
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)
Related Reference
ACC
Q9S0R5
NITE
Aver_00070
PmId
[7868391] Production of 6,8a-seco-6,8a-deoxy derivatives of avermectins by a mutant strain of Streptomyces avermitilis. (J Antibiot (Tokyo). , 1995)

close this sectionSequence

selected fasta
>cytochrome P450 [cytochrome P450 hydroxylase]
MPAPLQVPDVPGSWPVVGHLPQLARRPLDFLSSLADHGDLVRIRLGRKPVYVATHPDLVR
SLLVTDAHAYTRGAGHAKALAFIGPILVATTGEPHRRQRRMMQPCFHRQRLGSYVSAMCS
AATETADSWSAQDVVDVVPVMTELATAMIAKSLFVSERAAHAEAELRKTGNAILTVARMS
AILPGIYRRLPTPGNRQLPPARTVIEETIAAYRAEGQDHGDMLSTLLRTTDATGTGLTDE
EIRDEVMGLAITGIGGPAAIASWIFYELGQNPDLERRLHEELDTVLDGRPPSSQDLTRLV
FTQRLVKEALRKYPGWVGARRTRESVRLGGHEIPADAEVMYSAYALQNDPRWYPDPERFD
PDRWDPQQNATRVKKGAWVPFSGGVYKCIGDAFTETETAVAVAVIASRWRLRPADGRSVR
ASHLATHVVPRPLRMVVEPRSRNKDEAERSPHEAPQVSR
selected fasta
>cytochrome P450 [cytochrome P450 hydroxylase]
ATGCCTGCCCCTCTCCAAGTCCCCGATGTGCCGGGCTCGTGGCCGGTGGTGGGCCATCTG
CCCCAACTGGCCCGGCGGCCGCTCGACTTCCTGTCCTCCCTGGCCGACCACGGAGACCTG
GTCAGAATCCGGCTCGGCCGCAAGCCCGTCTACGTGGCCACCCACCCGGATCTGGTGCGG
TCGCTGCTGGTGACCGACGCACACGCCTACACACGAGGCGCCGGACACGCCAAGGCGCTG
GCCTTCATCGGACCGATCCTCGTCGCGACGACCGGTGAGCCCCACCGGCGCCAGCGCCGC
ATGATGCAGCCCTGCTTCCACCGGCAACGGCTCGGCAGCTACGTGTCCGCCATGTGCTCG
GCCGCCACGGAGACAGCCGACTCCTGGTCGGCCCAGGACGTGGTGGATGTGGTGCCCGTC
ATGACCGAGCTGGCCACAGCAATGATCGCCAAGTCGTTGTTCGTCTCCGAACGTGCCGCA
CACGCCGAGGCGGAACTGCGTAAGACCGGCAACGCCATCCTGACCGTGGCCAGGATGAGC
GCGATCCTGCCCGGGATCTACCGACGGCTGCCGACCCCTGGCAACCGGCAACTGCCCCCG
GCCCGAACCGTGATCGAGGAGACCATCGCCGCCTACCGCGCCGAGGGGCAGGACCACGGC
GATATGCTCTCGACGCTCCTGCGGACGACGGACGCCACCGGCACCGGACTGACCGACGAG
GAGATCCGCGACGAGGTCATGGGCCTGGCCATCACCGGAATCGGCGGGCCCGCCGCCATC
GCGTCGTGGATCTTCTACGAGCTCGGCCAGAACCCTGACCTCGAACGACGGCTGCACGAG
GAGCTCGACACGGTCCTCGACGGCCGGCCACCCAGCTCCCAGGACCTCACCCGGCTGGTC
TTCACCCAGCGGCTCGTCAAGGAGGCCCTGCGCAAGTACCCGGGATGGGTCGGCGCCCGG
CGCACACGAGAGTCGGTGCGCCTCGGCGGCCACGAAATCCCCGCCGACGCGGAGGTCATG
TACAGCGCCTACGCCCTCCAGAACGACCCCCGCTGGTACCCGGACCCCGAGCGGTTCGAC
CCCGACCGCTGGGACCCCCAGCAGAACGCCACGCGGGTCAAGAAGGGCGCCTGGGTTCCC
TTCTCGGGAGGTGTCTACAAGTGCATCGGAGACGCGTTCACCGAGACCGAGACCGCGGTG
GCCGTCGCCGTCATCGCCTCCCGGTGGCGGCTGCGCCCGGCGGACGGGCGCAGTGTCCGA
GCGAGCCATCTGGCCACCCATGTGGTCCCCCGGCCGCTCCGTATGGTCGTGGAGCCCAGG
AGCCGGAACAAGGACGAGGCGGAGCGCTCACCGCATGAGGCGCCACAGGTGAGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [270-283]  5.30000239467942e-06 PR00385 [304-315]  5.30000239467942e-06 PR00385 [379-388]  5.30000239467942e-06 PR00385 [388-399]  5.30000239467942e-06 PR00385
PR00385   P450
 [8-444]  1.10000000000001e-95 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [2-440]  3.99998544139406e-93 SSF48264
SSF48264   Cytochrome_P450
 [8-422]  3.30000000000002e-66 PF00067
PF00067   p450
IPR002401 Cytochrome P450, E-class, group I (Family)
 [34-53]  1.49999977583352e-15 PR00463 [261-287]  1.49999977583352e-15 PR00463 [342-366]  1.49999977583352e-15 PR00463 [378-388]  1.49999977583352e-15 PR00463 [388-411]  1.49999977583352e-15 PR00463
PR00463   EP450I
SignalP No significant hit
TMHMM No significant hit