close all open/close all

CDS information : Meili_00270


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction75,769 / 59,936 / - [in whole cluster]
75,769 / 59,936 / - [in contig]
Locationcomplement(59936..75769) [in whole cluster]
complement(59936..75769) [in contig]
TypeCDS
Length15,834 bp (5,277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)modular polyketide synthase
Gene
Gene (GenBank)meiA4
EC number
Keyword
Note
Note (GenBank)
  • similar to AVES 4
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)

close this sectionPKS/NRPS Module

10 malonyl-CoA
11 methylmalonyl-CoA
not conserved YASHS(Y->W)
12 malonyl-CoA
KS36..414
AT572..910
kr1213..1392
ACP1495..1565
KS1589..1965
AT2122..2439
kr2738..2891
ACP2999..3069
KS3093..3467
AT3650..3993
DH4045..4232
KR4603..4783
ACP4898..4968
TE5067..5269

close this sectionSequence

selected fasta
>polyketide synthase [modular polyketide synthase]
MANANEEKLRDYLKRATAELVQVRRRLAEIEAGEQEPIAVVGMACRFPGGVGSPAEFWEL
LASDGDAISGFPVDRGWNVEALYDPNPDRARTGTSYTRHGGFLHDAADFDAGFFGISPRE
ALAMDPQQRLLLETSWEALEGAGIDPATLRGSRTGVFAGMMYHDYATRLLELPDGLEGLV
GNGNAGGVLSGRLAYSFGFEGPAVTVDTACSSSLVALHLACQSLRSGECSLALAGGVTVM
STPGVFVEFSRQRGLAADGRCKPYAAAADGVGMSEGVAVLLVERLSDARRLGHRVLAVVR
GSAVNQDGASNGLTAPNGPSQQRVIRQALAGAGLAASDVDVVEGHGTGTTLGDPIEAQAI
LATYGQDRPEDRPLWLGSVKSNIGHTQAAAGVAGVIKMVLALAHGTLPRSLHVDAPTPHV
DWSAGRVRLLNESVPWPGNGRPRRAGVSSFGVSGTNAHIILEQAPDQVAAESEPTDESPV
VPWVVSARSEGALRGQARRLREFVAGRDELRGVARALAGERSVFERRAVIVAEDRDELVR
GLDALATGAPAPQLVERLTQPGDTDEPVVAVLFTGQGAQRVGMGRELYAAFPAFAAAFDA
VCAELTTAGGPDVRKLLLADADASTSASASASEGCERTEFAQPALFALEVALYRLVETAG
IRPRFLLGHSVGELVAAHVAGVLSLPDAARLVVSRGRLMQALPAGGAMAAMEISEREAGR
LLAEAETGSPEAAQVSLAAVNGPRSVVLSGDEDAVRELAGRCAERGHRTRRLRVSHAFHS
PRMDAMLEEFRREAERVTYHPARIPVVSNVTGAPLPAEEFGAPEYWVRHVRAAVRFGDGV
AWLRDQGVRTFLELGPDGTLCGLVQDVFAAEVPGADIEDAVLAAALRPDRGESQTYLAAL
ARLFVSGVEVDWPGAMGWTPGAVGGVELPTYAFERERYWLEAAGSDGSGAGGGEGPLWEA
VERGDVPRVGELLGVGEAAGLATLVPALGAWWRGCRDRGVLDGWRYREAWRPVGDGGPGA
PTGRWLVVAADGVDGSLVVEELERSGARAALHAAEGCVAREALVERLRAELGPESEVDGV
ALLLAGSGGGPGAGALLLVWLQALGDVGVAARLWCVTRGAVSVGGGDAVVSPGLGQVWGL
GRVAALEAPEVWGGLVDVPDPLDARAARSLVRALAGPERECAVRASGVFVRRLERAPLAG
AGAEPGREWRPHGTVLITGGTGGLGAQVARWLAGRGPVHLLLLSRRGEAAEGAAGLRDEL
AGLGARVTVAACDVADRDALTRVLAGVPEDAPLTAVVHAAGALDDAVLATLTPERLEAAR
QAKAVGAWQLHELTRGADLTAFVVFSSAAATFGSAGQGGYAAANAEVDALIQHRRGLGLP
GLSVAWGAWAGGGMADAAADAGRLRRHGMAAMDPRLALRALGHALEHDETCLTVADIDWR
AFVDNAPATGLDPLISGIPEARTAWDAAGRGAAEAAGTLRARLAGLAADEQRRMVVELVR
THAAAVLGHAGPAAVPPERAFRELGFDSLTAVELRNRLNAATGLRLPTTAVFDYPHPAAL
AQHTYEQLFGAPGTAGGPSSADLRPMATDEPIAVVGMACRLPGGVRSAEEFWELLAQGRD
AIAGFPMDRGWGGAALYDADPERPGTSYARAGGFLYDAADFDAGFFGISPREALAMDPQQ
RLLLETSWETFEKAGLDPADLRGSRTGAFVGMAQQDYVDLLRHTGEDLEGYAMTGVSGSA
LSGRLAYSFGFEGPAVTVDTACSSSLVALHLACQSLRSGECSLALAGGVTVMSTPGVFVE
FSRQRGLAADGRCKPYAAAADGVGWSEGVGMLLVERLSDARRLGHRVLAVVRGSAVNQDG
ASNGLTAPNGPSQQRVIRQALAGAGLAASDVDVVEGHGTGTTLGDPIEAQAILATYGQDR
PEDRPLWLGSVKSNIGHTQAAAGVAGVIKMVLSLQHELLPPSLHTNTPTPHVDWSAGRVR
LLSESVPWPGNGRPRRAGVSSFGVSGTNAHIILEQAPDEAVAESESTDESPVVPWVVSAR
SEGALRGQARRLREFVAGRDELRGVARALAGERSVFERRAVIVAEDRDELVRGLDALATG
APAAGLVEGPPAPAVHGKVAMLFGGQGTQWEGMAAELLDTAPAFADQMAACAEALAPHVD
WSLTDVVRGEPDAPPLDRADVVQPVLFAVMVSLAALWRSYGVRPDAVAGHSQGEIAAAYV
AGALSLEDAARIVALRSQALSALAGRGAMLSVGMPAPELEPRLAPWAGRLCVAADNGAGS
AVVSGTPEAVDALLAELAADGVRARKLNVDWASHSPQVEAIHERLLTLLAPIRPRTGDIP
LYSTVTGERMDGGGLDAEYWYRNLRQMVRFQDTTRALVEDGHTVFIESGPHPAVSVGVQE
TLDALGATDALVLGTLRRGEGGLSRFLTSVARLFVSGGAVDWSSAVGSAAGRRGSVELPT
YAFERHRFWLEPAPAVGGGAAQVADEPLWAAVRRGDVAGVGRLLGVGEGASLEVLVPALE
AWRQRCHDRESVDGLRYREVWRPAGVGGAGALMGRWLVVAADGARQAVVEGLERAGARVV
RVSPESGPDDHAVLVERLRAESEPEPAVTGLVLVADDEASESLQRALVQALSAMDAGARL
WCVTSGAVSLDCDDEPGSPASARAWDVARRVRLEAPERWGGLVDVAGAPDRRVVDGLIGV
LHGDERECAVRTSGVFVRRVVRAPLAGAVAERAWRPEGTVLIDGGALGPGPHTARWLAAR
GAEHLLLLDENGDGFGIADELSEAGVRVTTAACDPADRPALAQLLTAIPEEYPLRAVVHT
AQGDDGIAGAWNLHELTRDTDLSAFVVFSSAAPLLGAPGHGACAEAAALVQHRRGLGLPG
LSMTWGPWAVDGAGETGTAGAEAARPRSGRGVAAMDPRLALEALGQALDRGETCLTVADI
DWPHLVETATEAGLDPLISEIPEAREAWQLVRGDAGREPDGALRARLAGLAADERLRALV
ELVRTHAAAVLGHDGPAAVEPERAFRELGFDSLTAVELRNRLNIATGLPLPATVVFDHPN
PAALARGVHELLFGGGTATGSAVSVVRETAGTDEPIAVVGMACRFPGGVRSAEEFWQLLA
SGKDAIAEFPADRGWDVETLYDPDPERPGTSYTRAGGFLYDAADFDAGFFGISPREALAM
DPQQRLLLETSWEALERAGIDPRSLGGSRTGVFAGLALQDYAEVVRQGGPELAGYALTGI
SGSVLSGRLAYTFGFEGPAVTVDTACSSSLVALHLACQSLRSGESSLALAGGATVMSTPA
AFLEFSRQRGLAADGRCKAYAAAADGVGWSEGAGVLLLARLSDARRLGHRVLAVVRGSAV
NQDGASNGLTAPNGPAQQRVIRQALANADVPATGVDAVEGHGTGTTLGDPIEAQAILATY
GQDRPEDRPLWLGSVKSNIGHTQAAAGVAGVIKMVLALQHDLLPPSLYTDDPSPHVDWSS
GQVRLLTEPVPWPRNGHPRRAGISSFGVSGTNAHVILEQAPEEPGPESVPEDEDRNEDRN
EERDEERDEGQAAAVSTVVPWVVSARSEGALRGQAHRLREFAAEEENLRPVEVARALVTE
RAVFERRAVVVAEDREGFVRGLDALAAGVSATGLVAGAPRPGTDAGLALLFAGQGTQRIG
MGMELATAFPAYAHALDTVVTELDTRLDRSLRPLLFAAPGTDEAALLDRTRYAQPALFAV
EVALFRLLESFGVRPDFLVGHSLGELTAAHAAGVLTLRDAALLVAARGRLMEQLPPGGAM
VALWATEDEVAEALAGREALVSVAAVNGPRAVVVSGERSAVDDVAAAFTARGRKTRRLRV
GHAFHSPLMEPMLDAFREVAASLTYTEPAIGLVSNLTGELARPGELTDPEYWVRHVRHAV
RFNDGLVWLRAQGVNTFLELGPDGTLSALAQGDPEDDPEDDPAAERAAKSAAVSGVAPAA
DRIVSAPLLRPDRPEAHTLLTALARIHVHGVAVDWSAVIGPGPAGTVGRRRVELPTYAFD
RRRYWPRTHGQVADLSAAGLSAADHPLLGSAVELAGSQELLFTGRLSLRTHPWLADHAIF
DTVLLPGTAILELALRAGDEAGYDSVEELALQVPLVLPERGSVVLQLLLGAPTPDGRRPF
TLSSRHDDAHVAADQTWTCHATGALTRGGDPLGGAAGPAEGGVAEHEAADHEMAHETTEA
WPPPDAVPVDLTTWYVDLAGVGLGYGPAFQGLRAAWRHGDEFFAEVALDEERAADAARYA
LHPALLDAALHPVALGLDTAPGPDSQELGRLPFSWGGVTVGLVGASALRVRLTPVAQDTI
ALRATDGSGRLVVQARSLAFRPVTAERLRAAGTAYHEALFRLEWTPRSVAPTAPVSRRRW
ALVGPEVPGLAGALDEAGAEWRTYPHLAAVGEAVSRGDLSPDMVVFSCRAQEPGRQDPPG
DHLDPIPTTAITDLSAVTPEALRQAASGTLELLLSWLDDERFVDCRLALVTHGAVAATPA
DGVPDLTCAPVWGLVRSAQSEHPDRFVLADIDGRPGSQRALPEALLAGEPQFALRDGTVH
LPRVGRVAVAVPPADHPEDHPTDREDVRTAAEAVAPRTWDPDGTVLITGGTGVLGRMVAR
HLVTAHGVRHLLLTGRRGPAADGVPELVAELTRLGADATVRACDTADRHAVAELLSGIPV
RHPLRAVIHLAGVVDDGILTSLTAERMDAVLGPKAIGALHLHELTRDAGLDAFVVFSSAA
ASFGSPGQGNYTAANAFLDALMRHRRALDLPGQSLAWGMWARDSGMTGRLGATDRARMAR
GGLAPLTDEQGLALLDAAGTVDEAVLLATPLDFRALRAQAAAGGLPAILRGLVRAPARRA
ATATSATDATATTSGETPAALRERLAALPGGTERTGALLELVRTHAAAVLGHDAAETIDA
GEEFRELGFDSLTAVELRNRLSAVTGLRLATTLVFDHPSPGALARHMGERLDIEADAAAA
RPTPRHVPGPTHREGPSADTVESLFWVGHDTGRIHEAMQLLSAASVFRPSFRVGSGEVAP
KFVRLAQVAAEDATSGGEAAEHTPPVLICLPTVAAISSAYQYSRFASALQGLRDVWYAPA
PGFLVGELLPADVDAVTHLFAEAVLRFTEGAPFALAGHSAGGWLTYSVTSHLESLGVRPE
AVVAMDAYLPDEGIAPVASALTSEIFDRVTEFVEVDYTRLTAMGGYFRIFSGWTPPQIDT
PALFIRGRDGEQSPPVWGVPHTVMDVAGDHFTMLEEHAGATARHVDQWLRETAGWGG
selected fasta
>polyketide synthase [modular polyketide synthase]
ATGGCCAATGCCAATGAGGAAAAGCTTCGGGACTACCTCAAGCGGGCGACCGCCGAACTC
GTCCAGGTGCGCCGCCGCCTGGCGGAGATCGAGGCGGGGGAGCAGGAGCCGATCGCCGTG
GTGGGGATGGCCTGCCGCTTTCCCGGCGGTGTGGGGTCGCCCGCGGAATTCTGGGAGTTG
CTGGCCTCCGACGGCGACGCCATTTCGGGATTTCCGGTGGACCGGGGGTGGAATGTCGAG
GCGCTGTACGACCCGAATCCGGACCGAGCGCGGACCGGGACGTCTTACACCCGCCACGGC
GGCTTTCTCCACGACGCGGCGGACTTCGACGCGGGGTTCTTCGGGATCAGCCCGCGTGAG
GCGCTGGCGATGGACCCGCAGCAGCGGCTGCTGCTGGAGACCTCCTGGGAGGCGCTGGAA
GGCGCCGGAATCGACCCGGCCACGCTGCGCGGGAGCCGCACCGGCGTCTTCGCCGGGATG
ATGTACCACGACTACGCCACGCGCCTGCTCGAACTCCCCGATGGCCTCGAAGGGCTCGTC
GGTAACGGCAACGCCGGCGGGGTGCTGTCGGGTCGGTTGGCGTACAGCTTTGGTTTTGAG
GGTCCTGCGGTGACGGTGGATACGGCGTGTTCGTCGTCGTTGGTGGCGTTGCATTTGGCG
TGTCAGTCGTTGCGGTCGGGGGAGTGTTCGCTGGCGTTGGCGGGTGGGGTGACGGTGATG
TCGACGCCGGGGGTGTTTGTGGAGTTCTCCCGTCAGCGCGGTCTGGCGGCGGATGGGCGG
TGCAAGCCGTACGCGGCCGCCGCGGATGGCGTTGGCATGTCCGAGGGCGTGGCCGTCTTG
TTGGTGGAGCGGTTGTCTGATGCGCGGCGGTTGGGGCATCGGGTGTTGGCGGTGGTGCGG
GGTTCGGCGGTGAATCAGGATGGTGCGTCGAATGGTTTGACGGCGCCGAATGGTCCGTCG
CAGCAGCGGGTGATTCGGCAGGCGTTGGCGGGTGCGGGGCTGGCGGCGTCGGATGTGGAT
GTGGTGGAGGGGCACGGTACGGGGACGACGCTGGGTGATCCGATCGAGGCGCAGGCGATC
CTTGCGACGTATGGGCAGGACCGTCCGGAGGACCGGCCGTTGTGGCTGGGGTCGGTGAAA
TCGAACATCGGGCACACACAGGCGGCGGCCGGAGTCGCCGGTGTGATCAAGATGGTGCTG
GCCCTTGCACACGGGACGCTGCCTCGGAGTCTGCACGTGGACGCCCCAACCCCTCATGTT
GATTGGTCGGCCGGGCGGGTGCGGCTGCTGAACGAGTCGGTGCCGTGGCCGGGGAACGGG
CGCCCGCGCCGGGCGGGTGTGTCGTCCTTTGGGGTCAGCGGCACCAACGCGCACATCATC
CTCGAACAGGCTCCGGACCAGGTCGCGGCAGAAAGCGAGCCCACGGACGAATCGCCGGTG
GTGCCGTGGGTGGTCTCGGCGCGTTCGGAGGGCGCTTTGAGGGGGCAGGCCCGCCGGTTG
CGGGAGTTTGTCGCGGGCCGGGATGAGCTGCGGGGGGTGGCCCGTGCGCTGGCCGGTGAG
CGGTCGGTGTTCGAGCGCCGCGCCGTGATCGTGGCCGAGGACCGCGACGAACTCGTACGC
GGCCTGGACGCACTGGCGACCGGGGCACCGGCGCCCCAACTGGTGGAGCGCCTGACGCAG
CCGGGCGACACCGACGAACCCGTGGTGGCGGTGCTGTTCACGGGCCAGGGGGCGCAGCGC
GTCGGCATGGGACGCGAGTTGTACGCGGCGTTTCCCGCGTTCGCCGCCGCCTTCGATGCC
GTATGCGCGGAACTCACGACGGCGGGCGGCCCCGACGTACGGAAGCTGCTCCTCGCGGAC
GCCGACGCGTCCACATCCGCATCCGCATCCGCATCAGAGGGGTGCGAGCGCACCGAGTTC
GCGCAGCCCGCGCTGTTCGCGCTGGAAGTGGCGCTGTACCGGCTGGTCGAGACCGCGGGG
ATCAGGCCCCGGTTTCTGCTCGGACACTCGGTGGGAGAGCTCGTGGCCGCGCATGTGGCC
GGGGTGCTCTCGCTGCCGGACGCGGCGCGGCTCGTCGTCTCCCGCGGCAGGCTGATGCAG
GCGCTCCCCGCGGGCGGGGCCATGGCGGCGATGGAGATCTCGGAGCGGGAGGCGGGCCGG
CTGCTGGCGGAGGCGGAAACCGGCTCTCCCGAGGCCGCCCAGGTGAGCCTGGCCGCGGTC
AACGGCCCCCGCTCGGTGGTCCTGTCCGGGGACGAGGACGCCGTACGGGAGCTGGCCGGG
CGGTGCGCGGAGCGCGGCCACCGCACGCGGCGGCTGAGGGTGAGCCACGCCTTCCACTCG
CCCCGCATGGACGCGATGCTGGAGGAGTTCCGCCGGGAGGCGGAGCGCGTGACGTACCAC
CCCGCACGTATCCCGGTCGTGTCGAACGTGACCGGCGCCCCGCTACCAGCCGAGGAGTTC
GGCGCGCCCGAGTACTGGGTGCGGCACGTCCGCGCGGCGGTGCGTTTCGGCGATGGGGTG
GCGTGGCTGCGCGACCAGGGCGTCCGTACGTTTCTGGAGCTCGGCCCGGATGGCACACTG
TGCGGCCTGGTCCAGGACGTCTTCGCCGCCGAAGTGCCGGGAGCCGACATCGAGGACGCC
GTCCTGGCCGCGGCCCTGCGCCCCGACCGAGGCGAGAGCCAGACGTATCTCGCGGCCCTC
GCGCGGCTCTTCGTGTCCGGGGTGGAGGTGGACTGGCCAGGGGCGATGGGGTGGACGCCC
GGCGCGGTCGGCGGTGTCGAGCTGCCGACCTATGCCTTCGAACGGGAGCGTTACTGGCTG
GAGGCGGCCGGGTCCGACGGCTCCGGGGCGGGCGGCGGCGAGGGGCCGCTGTGGGAGGCG
GTGGAGCGGGGCGATGTCCCGCGCGTGGGTGAGCTGCTGGGGGTGGGCGAGGCGGCCGGT
CTCGCGACACTGGTGCCCGCGCTGGGGGCTTGGTGGCGAGGGTGCCGCGACCGTGGCGTG
CTGGACGGATGGCGCTATCGGGAGGCGTGGCGGCCGGTGGGCGACGGTGGTCCGGGGGCG
CCGACGGGGCGTTGGCTGGTGGTCGCCGCCGACGGGGTGGACGGATCGCTCGTCGTCGAG
GAGTTGGAGCGGTCCGGGGCCAGGGCGGCCCTCCACGCGGCCGAGGGGTGTGTGGCGCGC
GAGGCGCTGGTGGAGCGGCTGCGGGCCGAGTTGGGGCCCGAGTCCGAGGTGGACGGGGTG
GCGCTGCTGTTGGCGGGCAGCGGCGGCGGACCGGGCGCCGGGGCGCTGCTCCTGGTGTGG
CTCCAGGCATTGGGCGATGTGGGGGTGGCGGCTCGGCTGTGGTGTGTGACTCGTGGCGCG
GTGTCGGTGGGTGGCGGGGATGCGGTGGTGTCGCCCGGGCTGGGCCAGGTGTGGGGTCTT
GGCCGGGTGGCCGCCCTTGAGGCTCCGGAGGTGTGGGGCGGATTGGTCGACGTTCCCGAC
CCGCTGGACGCGCGGGCGGCGCGGAGCCTGGTGCGGGCGCTGGCCGGGCCCGAGCGGGAG
TGCGCGGTACGGGCGTCCGGGGTGTTCGTACGCCGACTGGAGCGGGCCCCGCTGGCCGGG
GCCGGGGCGGAGCCGGGGCGCGAGTGGCGGCCACACGGCACGGTACTGATCACCGGCGGT
ACGGGCGGGCTGGGCGCGCAGGTGGCTCGATGGCTGGCCGGCCGCGGCCCGGTGCATCTG
CTGCTGCTGAGCAGGCGCGGCGAGGCGGCCGAAGGCGCCGCCGGGCTCCGGGACGAACTG
GCCGGGCTGGGGGCGCGGGTGACCGTGGCGGCGTGCGATGTGGCCGATCGCGACGCGCTG
ACGCGGGTCCTGGCCGGCGTGCCGGAGGACGCCCCGCTGACGGCCGTCGTGCATGCGGCG
GGCGCGCTGGACGACGCCGTCCTGGCGACGCTGACCCCGGAGCGGCTGGAGGCCGCGCGG
CAGGCCAAGGCGGTCGGGGCGTGGCAGTTGCACGAGCTGACGCGCGGCGCCGACCTCACG
GCCTTCGTGGTGTTCTCCTCGGCGGCTGCGACGTTCGGCTCGGCGGGGCAGGGCGGCTAT
GCCGCGGCGAACGCCGAGGTGGACGCGCTGATCCAACATCGGCGCGGCCTTGGGCTGCCG
GGCCTGTCGGTGGCGTGGGGGGCCTGGGCCGGCGGTGGGATGGCGGACGCCGCCGCGGAC
GCCGGGCGGTTGCGCCGCCACGGCATGGCGGCCATGGATCCCCGGCTGGCTCTACGGGCG
CTCGGGCACGCGCTTGAGCACGATGAGACCTGCCTGACCGTCGCGGACATCGACTGGCGG
GCCTTCGTCGACAATGCCCCCGCCACCGGACTCGACCCCTTGATCAGCGGTATCCCCGAA
GCCCGGACGGCTTGGGACGCCGCGGGCCGAGGCGCCGCCGAGGCCGCCGGAACGCTCCGG
GCGCGGCTGGCCGGACTGGCCGCGGACGAGCAGCGGCGCATGGTGGTCGAGTTGGTCCGT
ACGCACGCGGCCGCCGTGCTCGGCCACGCCGGCCCGGCGGCCGTGCCCCCGGAGCGCGCC
TTCCGTGAGCTGGGCTTTGACTCGTTGACCGCCGTGGAGCTGCGCAACCGGCTCAACGCC
GCCACCGGCCTGAGGCTGCCCACCACAGCGGTGTTCGACTATCCCCACCCGGCCGCGCTC
GCCCAGCACACATACGAGCAGCTGTTCGGCGCCCCCGGAACGGCCGGTGGGCCGTCCTCC
GCCGATTTGCGGCCCATGGCGACGGACGAGCCGATCGCGGTGGTGGGGATGGCGTGCCGC
TTGCCCGGTGGTGTCCGCTCCGCGGAGGAGTTCTGGGAGCTGCTGGCCCAGGGCAGGGAT
GCGATCGCGGGCTTCCCGATGGACCGGGGCTGGGGCGGCGCGGCGCTGTACGACGCCGAT
CCGGAGCGCCCCGGCACCTCGTACGCGAGGGCGGGCGGTTTCCTCTACGACGCGGCGGAC
TTCGACGCGGGGTTCTTCGGGATCAGCCCACGTGAGGCGCTGGCGATGGACCCGCAGCAG
CGGCTGCTGCTGGAGACCTCCTGGGAGACCTTCGAAAAGGCCGGCCTCGACCCCGCCGAC
CTGCGGGGCAGCCGCACCGGAGCCTTTGTGGGCATGGCGCAGCAGGACTATGTGGACCTG
CTGCGCCACACCGGCGAGGACCTTGAGGGCTATGCGATGACCGGCGTCTCGGGCAGCGCG
CTGTCGGGTCGGTTGGCGTACAGCTTTGGTTTTGAGGGTCCTGCGGTGACGGTGGATACG
GCGTGTTCTTCGTCGTTGGTGGCGTTGCATTTGGCGTGTCAGTCGTTGCGGTCGGGGGAG
TGTTCGCTGGCGTTGGCGGGTGGGGTGACGGTGATGTCGACGCCGGGGGTGTTTGTGGAG
TTCTCCCGTCAGCGCGGTCTGGCGGCGGATGGGCGGTGCAAGCCGTACGCCGCCGCCGCT
GACGGAGTTGGCTGGTCCGAAGGGGTGGGGATGCTGTTGGTGGAGCGGTTGTCCGATGCG
CGGCGGTTGGGGCATCGGGTGTTGGCGGTGGTGCGGGGTTCTGCGGTGAATCAGGACGGG
GCGAGCAATGGTTTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATTCGGCAGGCG
TTGGCGGGTGCGGGGCTGGCGGCGTCGGATGTGGATGTGGTGGAGGGGCACGGTACGGGG
ACGACGCTGGGTGATCCGATCGAGGCGCAGGCGATCCTTGCGACGTATGGGCAGGATCGT
CCGGAGGACCGGCCGTTGTGGCTGGGGTCGGTAAAGTCGAACATCGGCCATACGCAGGCG
GCGGCGGGCGTCGCCGGGGTGATCAAGATGGTGCTGTCGCTCCAGCACGAACTGTTGCCA
CCGAGCCTGCACACGAACACTCCAACCCCTCACGTCGATTGGTCGGCCGGGCGGGTGCGG
CTGCTGAGCGAGTCGGTGCCGTGGCCGGGGAACGGGCGTCCGCGCCGGGCGGGTGTGTCG
TCCTTTGGGGTCAGCGGCACCAACGCGCACATCATCCTCGAACAGGCCCCGGACGAGGCC
GTGGCGGAGAGCGAGTCCACGGACGAATCGCCGGTGGTGCCGTGGGTGGTCTCGGCGCGT
TCGGAGGGCGCTTTGAGGGGGCAGGCCCGCCGGTTGCGGGAGTTTGTCGCGGGCCGGGAT
GAGCTGCGGGGGGTGGCCCGTGCGCTGGCCGGTGAGCGGTCGGTGTTCGAGCGCCGCGCC
GTGATCGTGGCCGAGGACCGCGACGAACTCGTACGCGGCCTGGACGCACTGGCGACCGGG
GCACCGGCCGCCGGACTGGTCGAGGGGCCGCCCGCCCCGGCCGTCCATGGCAAGGTGGCG
ATGCTGTTCGGCGGCCAGGGCACCCAATGGGAGGGCATGGCCGCCGAGCTCCTGGACACC
GCACCCGCGTTCGCCGACCAGATGGCGGCGTGCGCGGAAGCCCTCGCGCCTCACGTGGAC
TGGTCCCTGACCGACGTGGTGCGCGGCGAGCCGGACGCTCCGCCACTGGACCGGGCGGAT
GTGGTCCAGCCGGTGCTCTTCGCGGTCATGGTGTCGCTGGCGGCGCTGTGGCGGTCGTAC
GGTGTGCGGCCCGACGCGGTGGCCGGCCACTCCCAGGGCGAGATCGCCGCAGCGTATGTC
GCCGGTGCGCTGTCGCTGGAGGACGCCGCACGGATCGTCGCGCTGCGCAGCCAGGCGCTG
TCCGCGCTGGCCGGGCGGGGCGCGATGCTCTCGGTCGGCATGCCGGCCCCGGAACTCGAA
CCGCGCCTCGCGCCATGGGCCGGGCGGCTGTGCGTCGCGGCCGACAACGGCGCGGGCTCC
GCGGTGGTGTCCGGGACCCCCGAGGCCGTGGACGCGCTGCTGGCGGAGCTGGCCGCGGAC
GGCGTCCGGGCGCGTAAGCTCAACGTCGACTGGGCCTCCCACTCCCCGCAGGTCGAGGCC
ATCCACGAGCGCCTGCTCACCCTGCTTGCCCCGATCCGCCCCCGCACCGGCGACATCCCT
CTCTACTCGACCGTCACCGGGGAGCGCATGGACGGCGGCGGCCTCGACGCCGAGTACTGG
TACCGCAATCTGCGTCAGATGGTGCGCTTCCAGGACACCACCCGCGCGCTCGTCGAGGAC
GGCCACACGGTCTTCATCGAGTCCGGCCCGCACCCGGCCGTCTCGGTCGGTGTGCAGGAG
ACCCTTGACGCGCTCGGCGCCACAGACGCCCTGGTGCTGGGCACGCTGCGGCGCGGCGAA
GGGGGACTGAGCCGCTTCCTGACGTCCGTGGCGCGGCTCTTCGTCTCTGGCGGCGCGGTG
GACTGGTCCTCGGCCGTGGGGTCGGCAGCCGGCCGGCGGGGCAGTGTCGAACTCCCCACA
TACGCCTTCGAACGGCACCGGTTCTGGCTGGAGCCCGCGCCCGCGGTGGGCGGTGGCGCG
GCCCAGGTCGCCGACGAGCCGTTGTGGGCCGCGGTACGGCGGGGCGATGTCGCGGGAGTG
GGGCGGTTGCTGGGGGTGGGCGAGGGGGCATCGCTGGAGGTGTTGGTGCCGGCCCTGGAG
GCGTGGCGGCAGCGGTGCCACGATCGCGAGTCGGTGGACGGCCTGCGCTATCGGGAGGTG
TGGCGGCCGGCCGGGGTCGGTGGCGCGGGGGCGCTCATGGGGCGCTGGCTGGTGGTGGCC
GCGGACGGAGCGCGACAGGCGGTTGTCGAGGGGCTGGAGCGGGCGGGCGCACGGGTGGTG
CGGGTATCTCCGGAGTCGGGACCGGACGACCATGCGGTGCTGGTCGAGCGGTTGCGGGCC
GAGTCGGAGCCCGAGCCTGCGGTCACCGGGCTGGTGCTGGTCGCGGATGACGAGGCGTCG
GAGTCGTTGCAGCGGGCTCTGGTACAGGCGTTGAGCGCAATGGATGCGGGGGCTCGGCTG
TGGTGTGTGACCAGCGGGGCGGTGTCGCTCGACTGCGACGACGAGCCGGGGTCCCCAGCG
TCGGCCAGGGCGTGGGACGTGGCCCGGAGGGTGCGGCTTGAGGCTCCGGAGCGGTGGGGT
GGGCTGGTTGATGTGGCGGGCGCGCCGGACCGCAGGGTCGTCGACGGACTCATCGGAGTC
CTCCACGGCGACGAGCGCGAGTGCGCGGTGCGCACCTCGGGGGTGTTCGTACGCCGGGTG
GTGCGGGCTCCGTTGGCCGGGGCGGTGGCGGAGCGGGCGTGGCGGCCCGAGGGCACCGTA
CTGATCGACGGTGGCGCCCTTGGGCCGGGCCCTCACACGGCCCGGTGGCTGGCCGCCCGG
GGCGCTGAACACCTCCTGCTCCTCGACGAGAACGGCGACGGATTCGGGATCGCGGACGAA
CTCTCCGAGGCAGGGGTCCGGGTGACAACGGCGGCGTGTGACCCGGCCGACCGGCCAGCG
CTGGCGCAACTGCTGACCGCCATCCCGGAGGAGTATCCCCTGCGTGCCGTGGTGCATACG
GCGCAGGGGGACGACGGCATCGCGGGGGCGTGGAATCTGCACGAGCTGACACGCGACACC
GACCTTTCGGCGTTTGTGGTGTTCTCGTCGGCCGCGCCGCTCCTCGGCGCCCCGGGACAC
GGCGCCTGTGCCGAGGCTGCGGCCCTGGTGCAACACCGCCGCGGCCTGGGACTGCCGGGG
CTGTCCATGACCTGGGGCCCCTGGGCCGTCGACGGCGCCGGAGAGACCGGAACAGCGGGC
GCCGAGGCGGCCCGGCCGCGCAGTGGCCGTGGTGTGGCGGCCATGGACCCGCGGCTGGCC
CTGGAAGCGCTGGGGCAGGCGCTCGACCGCGGCGAGACCTGCCTGACCGTCGCCGACATC
GACTGGCCGCACCTGGTGGAAACCGCGACCGAGGCCGGGCTCGACCCCCTGATCAGCGAG
ATCCCCGAGGCGCGCGAGGCCTGGCAGCTCGTCCGAGGCGACGCCGGTCGCGAGCCCGAC
GGTGCGCTGCGCGCGCGGCTGGCCGGACTGGCCGCGGACGAGCGGCTGCGGGCGCTCGTC
GAGTTGGTCCGTACGCATGCGGCGGCCGTCCTCGGGCACGACGGGCCGGCAGCTGTGGAG
CCGGAGCGAGCCTTCCGTGAGCTGGGCTTCGACTCGCTGACGGCCGTGGAGCTGCGCAAC
CGGCTGAACATCGCCACCGGTCTGCCACTGCCCGCCACCGTCGTCTTCGACCACCCCAAC
CCGGCCGCGCTCGCCCGCGGCGTGCACGAGCTGCTGTTCGGCGGCGGGACCGCCACCGGC
TCGGCCGTGTCTGTGGTCCGCGAGACAGCGGGGACGGACGAGCCGATCGCGGTGGTGGGG
ATGGCGTGCCGCTTCCCCGGTGGTGTCCGCTCCGCGGAGGAGTTCTGGCAGCTGCTGGCC
TCGGGCAAGGACGCCATCGCGGAGTTTCCGGCCGACCGGGGCTGGGACGTGGAAACGCTC
TACGACCCGGACCCGGAGCGCCCCGGCACCTCGTACACGCGAGCGGGTGGTTTCCTCTAC
GACGCGGCGGACTTCGACGCGGGGTTCTTCGGCATCAGCCCCCGCGAGGCCCTGGCCATG
GACCCGCAGCAACGCCTGCTGCTTGAGACCTCTTGGGAGGCCTTGGAGCGGGCCGGAATC
GATCCGAGGTCGCTGGGCGGTAGCCGCACCGGCGTGTTCGCCGGGCTCGCGCTCCAGGAC
TACGCCGAGGTGGTGCGGCAGGGCGGGCCGGAGCTGGCGGGGTACGCGCTGACCGGGATC
TCCGGCAGTGTGCTGTCCGGCCGGCTCGCCTACACCTTTGGTTTCGAGGGCCCCGCGGTG
ACGGTGGACACGGCGTGTTCCTCATCGCTGGTGGCATTGCACCTGGCGTGTCAGTCGCTG
CGGTCCGGCGAGTCCTCACTGGCGCTGGCGGGCGGGGCGACGGTGATGTCCACACCGGCC
GCCTTCCTGGAGTTCTCCCGCCAGCGCGGGCTCGCCGCCGACGGCCGGTGCAAGGCGTAC
GCGGCCGCCGCCGACGGGGTCGGCTGGTCCGAGGGCGCGGGCGTACTGCTGCTGGCGCGC
CTTTCCGACGCGCGACGCCTGGGACACCGGGTGCTCGCGGTCGTACGCGGCAGCGCGGTG
AACCAGGACGGTGCGAGCAACGGGCTCACCGCGCCCAACGGCCCTGCCCAGCAACGGGTG
ATCCGCCAGGCCCTCGCCAACGCCGATGTGCCCGCCACCGGCGTCGACGCGGTGGAGGGG
CACGGTACGGGGACGACGCTGGGCGATCCGATCGAGGCGCAGGCGATCCTTGCGACGTAT
GGGCAGGACCGTCCGGAGGACCGGCCGTTGTGGCTGGGGTCGGTGAAGTCGAACATCGGC
CATACGCAGGCGGCGGCGGGCGTCGCCGGGGTGATCAAAATGGTGCTGGCACTCCAGCAC
GACCTGCTGCCACCGAGCCTGTACACCGACGACCCATCGCCGCACGTGGACTGGTCCTCG
GGCCAGGTGCGGCTGCTGACCGAGCCGGTGCCCTGGCCACGGAACGGACACCCCCGGCGC
GCGGGGATCTCCTCCTTCGGGGTCAGCGGGACCAACGCCCACGTCATCCTGGAACAGGCC
CCCGAAGAGCCCGGGCCCGAGTCCGTGCCGGAAGACGAGGACCGGAACGAGGACCGGAAC
GAGGAACGGGACGAGGAACGGGACGAAGGCCAGGCGGCAGCCGTGTCCACGGTGGTGCCA
TGGGTGGTGTCGGCGCGCTCCGAAGGGGCGCTGCGGGGCCAGGCACACCGGCTGCGGGAG
TTCGCCGCCGAGGAGGAGAACCTGAGGCCCGTGGAGGTCGCGCGGGCGCTGGTGACCGAG
CGGGCGGTGTTCGAGCGCCGCGCCGTCGTCGTGGCCGAGGACCGCGAGGGCTTCGTACGC
GGCCTGGACGCGCTCGCCGCCGGAGTGTCCGCAACCGGTCTGGTGGCGGGTGCGCCACGG
CCCGGAACCGACGCCGGGCTCGCGCTGCTCTTCGCCGGCCAGGGCACCCAACGCATCGGC
ATGGGGATGGAGCTGGCCACCGCCTTTCCGGCGTACGCCCACGCCCTGGACACAGTGGTC
ACCGAGCTTGACACCCGGCTCGACCGGTCGCTGCGCCCGCTGCTGTTCGCCGCGCCCGGT
ACGGACGAGGCCGCCCTGCTGGACCGTACCCGCTACGCCCAGCCGGCCCTGTTCGCGGTC
GAAGTGGCGCTGTTCCGGCTGCTGGAGTCCTTCGGCGTACGCCCCGACTTCCTGGTCGGC
CACTCCCTCGGCGAGCTGACCGCCGCACATGCCGCCGGGGTGCTCACCCTGCGGGATGCC
GCGCTGCTGGTGGCCGCGCGCGGCCGGCTCATGGAGCAGCTGCCGCCCGGCGGGGCGATG
GTGGCGCTGTGGGCCACCGAGGACGAGGTGGCGGAGGCCTTGGCGGGACGCGAGGCGCTG
GTGTCGGTGGCGGCGGTGAACGGGCCCAGGGCGGTGGTGGTCTCGGGGGAGCGGAGCGCG
GTCGACGACGTGGCTGCCGCGTTCACCGCACGGGGCCGCAAGACCCGGCGGCTGCGAGTC
GGCCACGCGTTCCACTCCCCGCTGATGGAGCCGATGCTGGACGCGTTCCGCGAGGTCGCC
GCCTCGCTGACGTATACGGAACCGGCCATCGGCCTGGTGTCGAACCTGACCGGAGAACTG
GCCCGTCCCGGCGAGCTGACGGACCCGGAGTACTGGGTGCGGCACGTCCGCCACGCCGTG
CGGTTCAACGACGGACTGGTGTGGTTGCGGGCACAGGGCGTCAACACCTTCCTGGAACTG
GGCCCGGACGGCACGCTGTCCGCCCTCGCCCAGGGCGACCCGGAAGACGACCCGGAAGAC
GACCCGGCAGCAGAGCGCGCCGCGAAGTCCGCGGCGGTGTCCGGCGTCGCGCCCGCGGCG
GACCGGATCGTGTCGGCACCGCTGCTGCGCCCGGACCGGCCCGAGGCCCACACCCTGCTC
ACCGCCCTCGCCCGGATCCATGTCCACGGCGTGGCCGTCGACTGGTCGGCGGTCATCGGC
CCCGGCCCGGCCGGGACGGTCGGCCGACGCCGAGTCGAGTTGCCGACGTACGCCTTCGAC
CGGCGCCGCTACTGGCCCAGGACCCATGGCCAGGTGGCGGACCTGTCGGCCGCCGGCCTG
AGCGCCGCCGACCACCCCCTCCTCGGCTCCGCCGTGGAACTGGCGGGATCCCAGGAACTG
CTGTTCACCGGGCGGCTCTCGCTGCGTACCCACCCCTGGCTGGCCGATCACGCCATCTTC
GACACCGTGCTGCTCCCGGGCACCGCGATCCTGGAGCTGGCCCTCCGCGCGGGCGACGAG
GCCGGCTACGACAGCGTCGAGGAGCTGGCCCTGCAAGTGCCCCTGGTGCTGCCGGAGCGC
GGTTCGGTGGTCCTCCAGCTCCTGCTCGGCGCGCCCACTCCGGACGGCCGACGCCCCTTC
ACCCTCTCCTCCCGCCACGACGACGCACACGTGGCGGCGGATCAGACCTGGACCTGCCAC
GCCACCGGGGCGCTGACCCGCGGCGGCGACCCGCTCGGCGGAGCGGCGGGCCCGGCGGAA
GGCGGGGTGGCGGAGCACGAGGCAGCGGACCATGAGATGGCTCATGAGACGACCGAGGCG
TGGCCGCCACCGGACGCCGTGCCCGTGGACCTGACCACCTGGTACGTCGACCTGGCAGGC
GTGGGCCTCGGCTACGGGCCCGCCTTCCAGGGGCTGCGGGCCGCGTGGCGGCACGGGGAC
GAGTTCTTCGCCGAGGTGGCGCTGGACGAGGAACGTGCGGCGGACGCCGCACGGTACGCG
TTGCACCCGGCGCTGCTCGACGCGGCGCTGCACCCCGTCGCGCTCGGCCTCGACACCGCG
CCCGGGCCGGATTCCCAAGAGCTCGGCCGACTGCCGTTCTCCTGGGGCGGGGTGACGGTC
GGCCTCGTCGGCGCCTCGGCGCTGCGGGTCCGGTTGACACCGGTGGCGCAGGACACCATC
GCGCTGCGGGCCACGGACGGCTCGGGGAGGCTGGTGGTCCAGGCACGGTCCCTGGCCTTC
CGGCCGGTCACCGCCGAGCGGTTGCGGGCGGCGGGCACCGCGTACCACGAAGCGCTGTTC
CGCCTCGAGTGGACACCGCGGTCCGTCGCCCCCACCGCGCCGGTCAGCCGGCGCCGATGG
GCCCTCGTCGGACCCGAGGTGCCGGGCCTGGCCGGGGCGCTGGACGAGGCCGGGGCGGAG
TGGCGGACGTATCCCCACCTGGCCGCGGTGGGCGAAGCCGTCTCCCGGGGCGATCTGTCC
CCGGACATGGTGGTGTTCTCCTGCCGGGCGCAGGAGCCCGGTCGCCAGGACCCGCCCGGC
GACCACCTCGACCCGATCCCCACGACCGCCATCACGGACTTGAGCGCCGTCACCCCGGAA
GCGCTGCGCCAGGCGGCCAGCGGCACGCTGGAGCTGCTGCTGAGCTGGCTCGACGACGAA
CGCTTCGTGGACTGTCGACTGGCCCTCGTCACGCACGGCGCGGTCGCCGCGACACCGGCG
GACGGGGTGCCGGACCTGACGTGCGCCCCTGTGTGGGGGCTGGTCCGCTCGGCCCAGAGC
GAGCACCCCGACCGGTTCGTGCTGGCGGACATCGACGGGCGGCCCGGCTCCCAGCGGGCG
CTGCCCGAAGCCCTGCTGGCCGGCGAGCCACAGTTCGCGCTACGGGACGGTACGGTCCAC
CTGCCCCGTGTGGGCCGTGTCGCCGTCGCCGTACCGCCCGCGGACCACCCCGAGGACCAT
CCCACGGACCGCGAAGACGTGCGGACCGCGGCGGAGGCCGTGGCCCCGCGCACCTGGGAC
CCCGACGGCACCGTGCTGATCACCGGCGGCACAGGTGTCCTGGGCCGGATGGTCGCCCGG
CATCTCGTGACCGCTCATGGCGTACGTCACCTGCTGCTGACCGGCCGCCGTGGACCGGCG
GCGGACGGCGTCCCCGAGCTGGTGGCCGAGCTGACCCGCCTGGGTGCCGATGCCACCGTC
CGGGCCTGCGATACGGCGGACCGTCACGCGGTTGCCGAACTGTTGAGCGGCATTCCCGTC
CGGCATCCGCTCCGTGCGGTGATCCACCTGGCGGGCGTGGTCGACGACGGGATCCTGACC
TCGCTGACGGCCGAGCGTATGGACGCCGTACTGGGGCCGAAGGCGATCGGCGCGCTGCAT
CTGCACGAGCTGACCCGCGACGCCGGCCTCGATGCCTTCGTCGTCTTCTCCTCGGCCGCG
GCCAGCTTTGGCAGCCCCGGCCAGGGCAACTACACGGCTGCCAACGCCTTCCTCGACGCG
CTGATGCGCCACCGGCGCGCGCTGGACCTGCCGGGACAGTCCCTGGCCTGGGGGATGTGG
GCCCGGGACAGCGGTATGACCGGGCGCCTCGGGGCCACCGACCGCGCCCGTATGGCCCGG
GGCGGCCTGGCGCCGCTGACGGACGAACAGGGGCTCGCCCTCCTGGACGCCGCCGGTACG
GTCGACGAGGCCGTACTGCTGGCCACTCCGCTGGACTTCCGGGCCCTGCGCGCACAGGCC
GCGGCAGGCGGGCTCCCGGCCATTCTGCGCGGCCTGGTCCGGGCGCCCGCCCGGCGAGCG
GCCACCGCCACCTCGGCCACGGACGCCACCGCCACCACGAGCGGCGAGACACCTGCCGCA
CTGCGCGAACGGCTCGCCGCACTGCCCGGCGGCACCGAGCGCACCGGCGCCCTCCTGGAG
CTGGTACGTACCCACGCCGCCGCCGTCCTGGGCCACGACGCCGCCGAAACCATCGACGCC
GGGGAGGAGTTCCGTGAGCTGGGCTTCGACTCCCTCACCGCGGTGGAGCTGCGCAACCGG
CTCAGCGCCGTCACCGGCCTGCGCCTCGCCACCACTCTGGTCTTCGACCACCCCAGCCCC
GGCGCACTGGCCCGCCACATGGGGGAACGACTGGACATCGAGGCCGACGCCGCCGCGGCA
CGACCGACCCCGCGCCACGTGCCCGGCCCAACCCATCGTGAAGGACCCTCGGCCGACACT
GTCGAGTCCCTTTTCTGGGTCGGACACGACACCGGACGCATCCACGAAGCCATGCAACTG
CTGTCGGCCGCCTCGGTCTTCCGGCCCTCCTTCCGCGTCGGCTCGGGCGAGGTGGCACCG
AAGTTCGTACGGCTCGCCCAAGTCGCGGCGGAAGACGCCACATCGGGAGGCGAGGCCGCC
GAGCACACCCCGCCCGTGCTGATCTGCCTCCCCACCGTGGCCGCGATCTCCAGCGCGTAC
CAGTACTCGCGCTTCGCCTCCGCGCTCCAGGGTCTGCGCGACGTCTGGTACGCGCCCGCA
CCGGGCTTTCTCGTGGGCGAGCTGCTGCCGGCCGATGTCGACGCCGTGACCCACCTGTTC
GCCGAAGCCGTACTGCGCTTCACCGAAGGTGCGCCCTTCGCCCTCGCAGGGCATTCCGCG
GGCGGCTGGCTCACCTACAGCGTGACCAGCCACCTGGAGAGCCTGGGGGTCCGCCCCGAG
GCGGTCGTGGCCATGGACGCCTATCTGCCCGACGAGGGGATCGCACCCGTCGCCTCCGCG
CTGACCAGCGAGATCTTCGACCGGGTCACCGAATTCGTCGAAGTGGACTACACCCGGCTC
ACCGCGATGGGCGGCTACTTCCGCATCTTCTCGGGCTGGACACCGCCGCAGATCGACACC
CCGGCGCTCTTCATCCGGGGCCGGGACGGGGAACAGTCACCGCCGGTCTGGGGGGTGCCG
CACACGGTCATGGACGTGGCCGGAGACCACTTCACCATGCTGGAGGAGCACGCGGGGGCG
ACCGCCCGCCATGTCGATCAGTGGCTGCGGGAGACCGCAGGCTGGGGTGGATAG
[10] KS36..414
[10] AT572..910
[10] malonyl-CoA776..780
[10] kr1213..1392
[10] ACP1495..1565
[11] KS1589..1965
[11] AT2122..2439
[11] methylmalonyl-CoA not conserved YASHS(Y->W)2311..2315
[11] kr2738..2891
[11] ACP2999..3069
[12] KS3093..3467
[12] AT3650..3993
[12] malonyl-CoA3842..3846
[12] DH4045..4232
[12] KR4603..4783
[12] ACP4898..4968
[12] TE5067..5269
[10] KS106..1242
[10] AT1714..2730
[10] malonyl-CoA2326..2340
[10] kr3637..4176
[10] ACP4483..4695
[11] KS4765..5895
[11] AT6364..7317
[11] methylmalonyl-CoA not conserved YASHS(Y->W)6931..6945
[11] kr8212..8673
[11] ACP8995..9207
[12] KS9277..10401
[12] AT10948..11979
[12] malonyl-CoA11524..11538
[12] DH12133..12696
[12] KR13807..14349
[12] ACP14692..14904
[12] TE15199..15807

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [5067-5269]  1.1e-24 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [564-702]  G3DSA:3.40.366.10 [776-899]  G3DSA:3.40.366.10 [2115-2243]  G3DSA:3.40.366.10 [2311-2429]  G3DSA:3.40.366.10 [3645-3774]  G3DSA:3.40.366.10 [3842-3981]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2738-2821]  3.3e-16 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1523-1538]  PS00012 [3027-3042]  PS00012 [4926-4941]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1488-1606]  2.49999811956465e-26 SSF47336 [2992-3110]  9.5000102816722e-28 SSF47336 [4890-4985]  3.1999989904635e-22 SSF47336
SSF47336   ACP_like
 [1495-1565]  PS50075 [2999-3069]  PS50075 [4898-4968]  PS50075
PS50075   ACP_DOMAIN
 [1498-1563]  1.3e-11 PF00550 [3002-3066]  1.2e-11 PF00550 [4901-4967]  8.80000000000003e-13 PF00550
PF00550   PP-binding
 [1493-1568]  3.19999999999996e-67 G3DSA:1.10.1200.10 [2998-3071]  3.19999999999996e-67 G3DSA:1.10.1200.10 [4897-4970]  3.19999999999996e-67 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1213-1391]  1.40000000000001e-59 PF08659 [2827-2889]  1.3e-13 PF08659 [4603-4781]  6.6999999999999e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [36-288]  1.39999999999997e-96 PF00109 [1589-1840]  4.2e-96 PF00109 [3093-3344]  1.39999999999997e-99 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-414]  3.29999999999997e-48 PF02801 [1848-1965]  7.69999999999997e-48 PF02801 [3352-3467]  8.30000000000004e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [572-910]  5.49999999999995e-63 PF00698 [2122-2439]  3.10000000000005e-105 PF00698 [3650-3993]  1.29999999999998e-63 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [6-36]  4.69999810630989e-07 SSF101173
SSF101173   Polyketide_synth_docking
 [4-29]  9.9e-12 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [569-870]  3.10001307370203e-65 SSF52151 [2118-2420]  8.89993011983204e-69 SSF52151 [3646-3936]  7.00003808422647e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [704-775]  1.80000149287196e-16 SSF55048 [2245-2310]  3.60000433965927e-18 SSF55048 [3776-3841]  1.50000306971104e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [38-300]  G3DSA:3.40.47.10 [301-467]  G3DSA:3.40.47.10 [1592-1852]  G3DSA:3.40.47.10 [1853-2019]  G3DSA:3.40.47.10 [3093-3355]  G3DSA:3.40.47.10 [3356-3523]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [28-412]  2.99998750445706e-103 SSF53901 [1582-1964]  1.09999184471405e-102 SSF53901 [3086-3522]  1.09999184471405e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1214-1398]  6.40000000000004e-79 G3DSA:3.40.50.720 [2737-2892]  2.79999999999994e-79 G3DSA:3.40.50.720 [4603-4813]  5.50000000000008e-68 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [201-217]  PS00606 [1753-1769]  PS00606 [3257-3273]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [572-890]  8.19994104549873e-116 SM00827 [2122-2420]  3.30001976117415e-124 SM00827 [3650-3973]  2.50000909916183e-111 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [5068-5269]  1.39999277195148e-96 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1496-1568]  1.20000117458134e-34 SM00823 [3000-3072]  2.50000909916183e-34 SM00823 [4899-4971]  2.9000035467798e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [4045-4232]  5.60004908290974e-76 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [38-466]  SM00825 [1592-2018]  SM00825 [3096-3522]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1213-1392]  3.59998852907783e-53 SM00822 [2738-2891]  1.69999922284049e-13 SM00822 [4603-4783]  1.40000506907309e-55 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit