close all open/close all

CDS information : Meili_00280


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction76,029 / 76,829 / + [in whole cluster]
76,029 / 76,829 / + [in contig]
Location76029..76829 [in whole cluster]
76029..76829 [in contig]
TypeCDS
Length801 bp (266 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)reductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • similar to Ave-orf1; orf22
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [reductase]
MLVTGAGSGIGQATAGAFAAAGARVVCVDRNARTASASADLAKVLGATDAWPEAVDVADA
ATMERLSERVLSAHGVVDVLVNSAGIGMSGRILDTSVADWRRTLDVNLWGVIHGCRLFGR
QMADHGQGGHIVTIASAAAFQPTRAVPVYATSKAAVVMLSECLRAELAQFGVGVSAVCPG
FVNTSFTAAMHFAGVSEQEQTRLRKRAVDTLGRRGCPPERVAAAVLRAVARNTPVVAVTP
DARLVRLISRFAPPLRRAVARLDPPS
selected fasta
>putative oxidoreductase [reductase]
GTGCTGGTCACCGGCGCGGGCAGCGGAATCGGACAGGCGACGGCGGGCGCCTTCGCCGCG
GCGGGGGCGCGGGTGGTCTGCGTGGACCGGAACGCCCGTACGGCGTCGGCCAGCGCGGAC
CTGGCCAAGGTATTGGGCGCCACCGACGCATGGCCGGAGGCCGTCGACGTCGCCGACGCG
GCCACCATGGAACGTCTCTCCGAGCGCGTCCTGAGCGCGCACGGGGTTGTGGACGTCCTG
GTGAACAGCGCCGGCATCGGCATGTCGGGCCGGATTCTCGACACCTCCGTCGCGGACTGG
CGGCGCACGCTGGACGTGAATCTATGGGGGGTCATTCACGGCTGCCGGCTCTTCGGCCGG
CAGATGGCGGACCACGGGCAGGGCGGGCACATCGTGACGATCGCGTCGGCCGCCGCCTTC
CAACCCACGCGGGCGGTCCCGGTGTACGCGACGAGCAAGGCCGCCGTGGTGATGCTCAGC
GAATGTCTGCGGGCGGAACTCGCGCAGTTCGGAGTGGGTGTGAGCGCGGTGTGCCCGGGC
TTTGTGAACACCTCCTTCACGGCGGCGATGCACTTCGCGGGGGTGTCGGAACAGGAGCAG
ACGCGGCTGCGGAAGCGGGCCGTCGACACGCTGGGGCGGCGCGGCTGTCCGCCGGAGAGA
GTCGCCGCGGCGGTGTTGCGCGCGGTCGCCCGCAACACGCCCGTGGTGGCTGTGACGCCG
GATGCCCGTCTCGTGCGCCTGATCAGCCGGTTCGCGCCGCCTCTGCGCCGTGCCGTGGCC
CGGCTCGATCCGCCCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [75-86]  4.19999771339581e-10 PR00080 [129-137]  4.19999771339581e-10 PR00080 [149-168]  4.19999771339581e-10 PR00080
PR00080   SDRFAMILY
 [1-167]  1.5e-29 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [75-86]  2.60000517657733e-18 PR00081 [123-139]  2.60000517657733e-18 PR00081 [149-168]  2.60000517657733e-18 PR00081 [170-187]  2.60000517657733e-18 PR00081 [210-230]  2.60000517657733e-18 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-243]  6.80000000000006e-62 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [136-164]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-19]  0.89 Signal
Bacteria, Gram-negative   
 [1-23]  0.658 Signal
Eukaryota   
 [1-37]  0.364 Signal
Bacteria, Gram-positive   
TMHMM No significant hit