close all open/close all

CDS information : Meili_00290


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction77,679 / 76,867 / - [in whole cluster]
77,679 / 76,867 / - [in contig]
Locationcomplement(76867..77679) [in whole cluster]
complement(76867..77679) [in contig]
TypeCDS
Length813 bp (270 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-5 ketoreductase
Product (GenBank)C5-ketoreductase
Gene
Gene (GenBank)meiF
EC number
Keyword
Note
Note (GenBank)
  • similar to AveF; MeiF
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)
Related Reference
ACC
Q9S0N7
NITE
Aver_00020
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
ACC
Q9ZGC1
NITE
Lando_00190
PmId
[16283688] LanV, a bifunctional enzyme: aromatase and ketoreductase during landomycin A biosynthesis. (Chembiochem. , 2005)
[22633416] Tailoring enzymes involved in the biosynthesis of angucyclines contain latent context-dependent catalytic activities. (Chem Biol. , 2012)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)

close this sectionSequence

selected fasta
>putative C-5 ketoreductase [C5-ketoreductase]
MTQTAGKTALVTGASRGIGAAIARRLAAEGVLVAVHYGRCKADAEETVASIEQAGGQAFA
IRADLAADDALDTLFSELATGLAGRPLNILVNNAAIYADPDDPAAAQADGYVAGISEVTQ
EEFDRIFSVNVRAPFFVTQRCLPLLADGGRIVNISSAVTRIAWPLLPYAMSKGALEIMAP
RLANELGHRGITVNTIAPGITDNTKTNTWLHDMPGAAEGVAAMTALRRLGQPSDIADVVA
LLASDEARWVTGQLVDASGGMALAPTPPGM
selected fasta
>putative C-5 ketoreductase [C5-ketoreductase]
ATGACCCAAACAGCTGGAAAAACCGCACTGGTGACCGGTGCGTCGCGGGGCATCGGCGCG
GCCATCGCCCGAAGGCTCGCCGCCGAAGGTGTTCTGGTGGCCGTGCACTACGGGCGGTGC
AAAGCGGACGCGGAGGAAACGGTCGCGTCGATCGAGCAGGCCGGCGGGCAGGCATTCGCC
ATCAGGGCGGACCTTGCGGCCGACGACGCCCTCGACACGCTCTTCAGCGAGCTCGCGACC
GGGCTCGCCGGCCGGCCGCTGAACATCCTGGTGAACAACGCCGCCATCTACGCCGACCCG
GACGACCCGGCCGCCGCGCAGGCGGACGGCTATGTGGCGGGCATTTCCGAGGTCACTCAG
GAGGAGTTCGACCGTATCTTCAGCGTCAATGTACGTGCCCCGTTTTTCGTCACCCAACGG
TGTCTGCCGCTCCTCGCCGACGGCGGACGGATCGTCAACATCTCTTCCGCCGTCACCAGG
ATCGCCTGGCCGCTGCTGCCCTACGCCATGAGCAAGGGCGCCCTCGAGATCATGGCGCCC
AGGCTGGCCAATGAGCTGGGACACCGGGGAATCACCGTCAACACCATCGCGCCGGGCATC
ACCGACAACACCAAAACCAACACGTGGCTGCACGATATGCCCGGGGCGGCCGAGGGCGTG
GCCGCCATGACCGCACTGCGCCGACTCGGTCAGCCGTCCGACATCGCCGATGTCGTCGCC
CTCCTCGCCTCGGACGAGGCCCGCTGGGTCACCGGACAACTGGTCGACGCCTCCGGCGGC
ATGGCCCTGGCCCCCACACCACCGGGCATGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [7-186]  1.1e-28 PF00106
PF00106   adh_short
 [85-96]  3.19999899046351e-07 PR00080 [149-157]  3.19999899046351e-07 PR00080 [168-187]  3.19999899046351e-07 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  2.69998997787809e-33 PR00081 [85-96]  2.69998997787809e-33 PR00081 [143-159]  2.69998997787809e-33 PR00081 [168-187]  2.69998997787809e-33 PR00081 [189-206]  2.69998997787809e-33 PR00081 [225-245]  2.69998997787809e-33 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [3-263]  1.69999999999998e-75 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-28]  0.401 Signal
Bacteria, Gram-positive   
TMHMM No significant hit