close all open/close all

CDS information : Meili_00300


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction78,601 / 77,846 / - [in whole cluster]
78,601 / 77,846 / - [in contig]
Locationcomplement(77846..78601) [in whole cluster]
complement(77846..78601) [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf23
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MRWRHHGIANGRRRPAKAGRRQPCRRSRHGTVTHAARLTQLTQLTQLTQLIRLIRLIRSA
GVGSATGCRYSSAARRPRRPRSPLRRPRPKPRGPPRGG-P-PCQRPPPRQPPD-CVPRPR
SRSRRPSRRPRPLPERPLPRRGRPGHRRRLPRPRPRPLGRRPLWRPRSTAHARFLRPRPW
RSGPRLPRPRRRSPALPRPRPRRCSRRRRPPSPWPLRTRPREWRRRWPPPAWRRSARAVR
GCRDRVPPLSD
selected fasta
>hypothetical protein [hypothetical protein]
ATGCGGTGGCGTCATCACGGCATCGCAAACGGGCGACGGCGCCCGGCCAAGGCCGGGCGC
CGTCAACCGTGTCGCCGCTCAAGGCACGGCACGGTCACTCATGCCGCACGACTCACTCAG
CTCACTCAGCTCACTCAGCTCACTCAGCTCATTCGGCTCATTCGGCTCATTCGGTCGGCA
GGTGTCGGCTCAGCCACGGGGTGTCGGTATTCATCCGCAGCGCGGCGGCCTCGGCGGCCT
CGGTCACCGCTTCGGCGCCCCCGTCCCAAGCCGCGCGGCCCGCCTCGCGGCGGTGGNCCC
GNCCCTTGCCAACGGCCTCCGCCTCGGCAGCCGCCCGACGNCTGTGTTCCGCGACCACGT
TCGCGATCTCGGCGGCCTTCGCGGCGGCCTCGGCCTCTGCCCGAGCGGCCGCTTCCGCGG
CGGGGCCGGCCTGGGCACCGGCGGCGGCTGCCGCGGCCGCGGCCTCGGCCGCTCGGGCGG
CGGCCGCTGTGGCGGCCTCGGTCGACAGCGCATGCCCGGTTTCTCCGGCCGCGGCCCTGG
CGGTCCGGGCCGCGGCTTCCGCGGCCGAGGCGGCGGTCGCCAGCGCTTCCGCGGCCTCGG
CCACGGCGGTGCTCACGGCGTCGCCGTCCGCCGTCGCCTTGGCCACTTCGGACGCGGCCG
CGCGAGTGGCGGAGGCGATGGCCTCCGCCCGCCTGGCGGCGCTCAGCGCGCGCCGTACGG
GGATGTCGGGATCGTGTTCCGCCGTTGTCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-35]  0.249 Signal
Bacteria, Gram-negative   
TMHMM No significant hit