close all open/close all

CDS information : Meili_00310


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction96,074 / 78,606 / - [in whole cluster]
96,074 / 78,606 / - [in contig]
Locationcomplement(78606..96074) [in whole cluster]
complement(78606..96074) [in contig]
TypeCDS
Length17,469 bp (5,822 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)modular polyketide synthase
Gene
Gene (GenBank)meiA3
EC number
Keyword
Note
Note (GenBank)
  • similar to AVES 3
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)

close this sectionPKS/NRPS Module

7 methylmalonyl-CoA
not conserved YASHS(S->C)
8 malonyl-CoA
not conserved HAFHS(H->G)
9 methylmalonyl-CoA
not conserved YASHS(S->C)
KS39..414
AT588..906
DH957..1133
ER1477..1779
KR1789..1969
ACP2070..2140
KS2167..2543
AT2698..3013
DH3061..3236
KR3574..3754
ACP3858..3928
KS3955..4330
AT4490..4808
DH4859..5037
KR5380..5560
ACP5661..5731

close this sectionSequence

selected fasta
>polyketide synthase [modular polyketide synthase]
MEIPMAAGHDKVIEALRASLKTNERQREQIHRLTTAAREPIAIIGMACRYPGGVGSPEDL
WELVAAGRDAIGTFPEDRGWDAARLYDPDPERAGTSYTQHGGFLYQAGEFDPGFFGISPR
EALAMDPQQRLLLEISWEAFERAGIDPASVRGSRTGVFAGVMYHDYGSRLHTVPEGFEGY
VGNGSGGGVASGRVAYTLGLEGPAVTVDTACSSSLVALHLACQALRAGECSLALAGGVTV
MSTPSLFVEYSRQRALAADGRCKAYGAGADGTGWAEGAGMLLVERLTDAQRLGHRVLAVV
RGSAVNQDGASNGLTAPNGPAQQRVIRQALASAGVSASEVDAVEGHGTGTRLGDPIEAQA
LLATYGQQRPADRPLWLGSMKSNVGHAQAAAGVGGIIKMVMAMRSGTLPRTLHADEPSPH
IDWDSGAVRLLTEPVAWPERDRPRRAAVSSFGVSGTNAHVILEAASQTAPHTESASQTET
DDAPAPHGAPGHAVAGPLPWPLSGATAEALRAQARELRRFVAADELLRPADVGHTLVLGR
SDLAHRAVVLGSDRETLLRGLDTLTGEGPDGGSVVRGVAAAGAGAGVVFVFPGQGGQWAG
MGLRLLETSSFFAERMAECEAALAPYVDWSLLDVLRRDPGDPVWERADVVQPMLFSVMVS
LAQLWRSYGVEPDAVLGHSQGEIAAAHICGALTLDDAAKVVALRSRALQTLRGSGGMASV
PLTADEVAGLLRTAWPDRLWVAAVNAPTATVISGDADSLAEALEHYRDQGVDAKRVPVDY
ASHCPHIEAVEQELLSLLRGIAPRAADIPFYSTVDNQWADTMGLDARYWYRNLRRPVRFA
EALRALGAAEYRSYVEVGPHPTLTPAIEDTTEAAGAAATVVGSLRRGEDDAHRILTSLAR
AHIHGLPVAWDRHYRALAPEANHVDLPTYAFQRRRYWLDAPATTGDVTAAGLAPVGHPLL
GAAVGLAEGDGYLLTGRLAPHTHPWLTDHAVAGTVLLPGTAYVELAVHVGEHLGCPRLEE
LTLHAPLVLPDTGGVALQVAVGAPDETGRRALSVYAQRDDDPTWEGAARGAWTRHATGTL
AAEAATDGINGADGAGPLAGAWPPPGAEPLDISGLYDTLAAADFGYGPAFQGLRAVWRHG
EETYAEVRLPDQVAADAPRFCLHPALLDAALHPLALDSGRSEENPAGHGLLPFAWRGVSL
RSPGTPTLRVRLRPQGPDSIAVDVADETGASVVSAESLTLRPVALEDLRVLGGQANDPLY
ALEWTAAPEPLTTALGRCAVLGHATPGWAAALETAAAEPVRRYPDLAGLVAALDAGDPPP
DLVFVGCPPAAAGPDDTTVADVHTTRTRVRTRQALELLQGWLGEARLAGARLVLVTRGAV
ATGPAGGGMDLAGAAICGLVRSAQAEEPDRILLVDLDTAEESWAALPRAVALGEPQMAIR
AGQPHMARLVRADTERDALLTPPRGSGGWRLDCADAGTLQGLAPVASSADHDPLGPQQVR
IEVRAAGLNFRDVLVALGMVPGQQGLGSEGAGVVLEAGPEVADLAPGDRVMGVFADAFGP
FAIADRATVIRVPEHWTFAQAAAVPVVFATAYYGLVDLAGLRPGESVLVHAAAGGVGLAA
VQLARHLGAEVYATASPGKWDTLRAHGIPPERIASSRTLDFESRFTGRNIDVVLNSLAHE
YVDASLRLVSGDSGRFLEMGKTDLRDPEEVAEAYPGVAYRAYDLMEAGPERIGEILRTVL
RLFDEGVLTPLPLTCWDIRQARDAFRQLQQGRTVGKNVLTLDRTPDPDGTVLITGGTGTL
GAALARHLAATGRARHLLLISRRGLDAPGAPELIAEIDELGAATTVATCDVGDRAALAEL
LGRIPAEHPLTAVVHAAGTLDDATLGSLTARHLDTVLPAKADAAWHLHELTCRLDLAAFV
LFSSAAGVLGSPGQGNYAAANAFLDALAFQRRAMGLPAVSLAWGLWEEASGMTGHLDQTD
RTRMARVGLRPLATNEALALFDNALVDGPPLLLPARIDTKALRGTTAPPLFQSLVRPTTG
HRPRPATPDGRSSLRARLAGLDPAAQHEVLLTLVRGHAATVLGHPSPDAIAPEAAFRDLG
FDSLTAVELRNRLKEATGLRLPATLVFDHPTPAALAQHLRDGLIGGADAATLASAPAPSE
VATVADEAIAIIGMACRYPGGVRSAEGLWDLVASGTDAMSGFPTDRGWDLDRLYAPQDQD
RPGTTYTRHGGFLHDAGKFDAGFFGIGPREALAMDPQQRLLLETSWEVFEHAGIDPSSVR
RSRTGVFAGVMPTDYGPRLQDTVAEVEGYVLTGNSGSVASGRIAYTFGLEGPAVSVDTAC
SSSLVALHLACQALRAGECSMALAGGVTVMATPGAFVEFARQRGLSVDGRCKAFGVGADG
TGWAEGVGMLLVERLSDARRLGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALA
SARVGGADVDVVEGHGTGTRLGDPIEAQALLATYGQERSGDEPLWLGSVKSNIGHAQAAA
GVAGVIKMVMAMRCGVLPRTLHVQEPSPHVDWSSGGVRLLTEAVPWPETGRARRAGVSSF
GVSGTNAHIILEQAPPEEHDDPADVSSGSFPWMVSAKSEQALQAQAAQLRAYLAARPGVG
LADVGYALAAGRTAFDHRAVLLGPDREAFLEGLGALGAGEEHAGLVRGVATGAGKLAFVC
SGQGTQRPRMGHELYRAFPLFAAAMDEACAYLDPHLDRPLRDVVFAEPDSGTARLLQQTR
YAQPALFALQVALHRLVTEHYGLTPHYYAGHSLGEITAAHLAGILTLCDAARLVTTRARL
MQSLPATGAMTTLQADPDELHEHLARCEGRVSLAAVNAPGSVVISGDRHDVDATAENFRA
MGRKTTPLKVSGAFHSHHIDPLLDELRATAETLTYHPPHTPLITTDLTDQDPTTPGYWVR
QTRETVHYAHTTQQLHTHGVTAYLELGPDTTLTTLTHHNLPHHTPLAIPLLHPDQPETHT
THTALAHLHTHGHPTTWHHHHTPTHHHPNLPTYPFQHHHYWLNTTTATGDMSAAGLEPAR
HPLLGAAVELADGEGLLFTGRISLRTHPWLADHAVGGAVLLPGTAFLELALEAAAHVDCH
RIEELTLHTPLVVPESGGVVLQVTVAGPNEAGNRAVDIYSRIDVGGLTADSVGEPWTRHA
AGYLADKPGPDCGDSADGVMPAGAWPPPGAVAVDLEELYEQLAEGGFHYGAAFRCLDAAW
QRGDEVFATVHMSENQLGDTAAARFALHPALLDSALHTIPLLPSLQGQQDSGLPFTWAGV
TLRASGATALRVRLRPDGHGPGAVSVDVSDEAGEPVASVRSLALRPVTRVELHTAELRTA
APVAPHSSLFEVRWEPVPQPSAAEEADPWVMIGTGPTLRPDEDFATPPERTYADLAALCA
AVADGAPVPRTVVAWSQAGSEDESSEALRHATHHMLGLLQQWLADSRFVDSRLVILTRAA
VATAPEEEVKDLAGAATRGLIRSAQSEHPDRFVLLDLDDRPADAKDHDRMLSVALACGEP
EVAVRDGALRTPRLSPLAGTATEAMDEHPWDPDGTVLITGGTGSLGAMLARHLVATHGVR
HLLLISRRGLDAPGARRQGNELVELGAQLTIAACDAADQRQLANALSEISVDHPLTAVVH
AAGVLDDGVITSLTPEDLTHVLRAKVDSALNLHQLTRDLPLSAFVLFSSLAGVMGSAGQG
NYAAANAALDALASHRRATRLPAVSLAWGVWEQTEGMTGQLEATGHARLRRSGLRPLATS
EGLELFDKALSCGHALVVPAALSTKELQTSGSVPPFLRHVTGVAPARPSRTRDASAGEPT
PLRRRLTGLGPEERLREVLRLVRSRAAAVLGHGTAEAVPADSAFRDLGFDSLAAVDLRNR
LQQATGLRLPAGLIFDRPRPDVLARFLCDELAGVGGTSAATAAPPVAAVGGAAGEPVAIV
GMACRFPGGVRSAEGLWDLVASGMDAVGDFPTDRGWEVERLYDPDPDRTGTSYTRQGGFL
YDAGEFDAAFFGIGPREAVAMDPQQRLLLEISWEALERAGIDPASLRGSSTGVFAGVMYH
DYGTRLREIPEGYEGYIGNGNAGSVASGRVSYTFGLEGPAVTVDTACSSSLVALHLACQA
LRSGECSMALAGGVTVMSTPTTFVEFSRQRGLAPDGRCKSFGAGADGTGWAEGAGMLLVE
RLSDARRNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQERVIRQAWANAGVAAMDIDAVE
GHGTGTTLGDPIEAQALLGTYGQGRSADRPLWLGSIKSNVGHTQAAAGVGGVIKMVMAMR
HGLLPQTLHAEEPSPHVDWSGGTVRLLTEPVAWPERGRMRRAGVSSFGVSGTNAHVILEQ
APPNAETHEPAEPHTAPGPLPWTISAKSPQALRAQARQLHTYLTNTPEANPADVGHTLAM
GRASFEHRAVVIGSDRGEFLGGLDAVAADEAHSAVVTGIARKAGDLGKVVFVFPGQGGQW
AGMGLRLLKTSPVFAQSIQACEQALAPHTDWTLTDILHRPHTDPLWQRADVIQPALFALM
TSLTTLWQSHGLNPDAVIGHSQGEITAAHACGALSLEDAAKIVALRSQTLQTLQGSGGMA
SVPLPADQVTALLHTMWPDQLWVAAINAPTTTVISGDTQALTQALNHYRDQDIDAKRIPV
DYASHCPHIQAVQHELSDLLQDITPRAATTPFYSTTDNQWTDTTTLNAHYWYRNLRQPVH
LTNAITNLTHQGHHTYIEISPHPTLTPAIQETTHTTHTPTTVISTLRRNHNDTHQLLHAL
AHAHTTGHPINWHPTHQHHTPTPQHTDLPTYPFQHQRYWLNTPTQTGDAAAIGLDPAHHP
LLGAAVAVAEGEGYLLTGRLALSTHPWLADHTIAGAVVLPGTALLEIALQAGHRVDCHRI
EELTLQSPLFIPEEGAVQVQAWVAAPDENGYRSLTVSSRREGTYEDATWVRHATGRVGPA
PADQDDAIARLTDPQGDGAAAVWPPQGAVAFTADDLEGLYDGYAARGFEYGPVFRGLRAA
WRRGEDIFAEVRLPDTADGDASQFSVHPALLDAALHAAAFRPADELPHGALPFSFSGVRL
HGPGASTLRVRLTPDGQARDTHAWSVAVVDGEGRPVASIASLAVRPVSTQELLAASGTAR
RDSLFAVEWVTAPAPTSSSAPRRLATVGPSDRLPSADAYANLADLAAAVLEAEAPAPDAV
VVDCGRRDARATAVAEDVRTLTRRILGLLQEWLADERPASSRMVVLTRGAVATTPGEDVA
DLAGAAVCGMVRSAQSEHPGRFVLLDLDPDPDLDGGEVPPTVVPAALACGEPQIAVRANR
HLVPRLTRVPVSVPVPGPVPVPAAEAADQDTTPTAFDPDGTVLITGGTGTLGAVLARHLV
SRHGVRHLLLASRRGPDAPGATELRAELAELGAEATVRACDTGDRGALADLIAGIPTGHP
LTGVVHAAGVLDDATVASLTPRHLDTALTPKADAAFHLHELTRHARPRAFVLFSSAAGVL
GAAGQGNYAAANAFLDALAEHRRAQGLPALSLAWGLWEQGSGMTGHLDRTDRARINRSGL
APLATEDALALFDAALAGDRPFLVPARLDLRGSSAAETPAPLFSRIAPARTTRGRTPGAE
GAADLRTRLAAQDATEQRDTLLTIVRTHTAAVLGHDTAAAVRPDAAFRELGFDSLAAVEL
RNRLQTTTALTLPATTVFDHPTPAALADHLRTQLCQDAPSPAAATAMAAMAELARLESAV
SDSAALDDDTRSGLAERLRSLARKMSSGRVVDHNGGGAAGLDLQSATDDEMFELIDKEVS
RD
selected fasta
>polyketide synthase [modular polyketide synthase]
TTGGAGATACCGATGGCCGCTGGCCACGACAAGGTGATCGAGGCGCTGCGGGCGTCCCTC
AAGACCAACGAGCGGCAGAGGGAACAGATCCACCGGCTCACTACGGCGGCGCGGGAACCC
ATCGCCATCATCGGCATGGCCTGCCGCTATCCCGGCGGAGTGGGATCGCCGGAGGACCTG
TGGGAGCTGGTGGCCGCCGGCCGTGACGCCATCGGCACCTTCCCCGAGGACCGGGGCTGG
GACGCGGCGCGGCTGTACGACCCCGATCCGGAGCGGGCCGGCACCTCGTACACCCAGCAT
GGCGGATTCCTTTACCAGGCAGGGGAGTTCGACCCCGGTTTCTTCGGGATCAGCCCGCGC
GAGGCGCTGGCGATGGACCCGCAGCAGCGGCTGCTGCTGGAGATCTCCTGGGAGGCGTTC
GAGCGGGCCGGGATCGACCCGGCCTCGGTGCGCGGCAGCCGCACCGGGGTCTTCGCGGGC
GTCATGTACCACGACTACGGCTCCCGGCTGCACACCGTCCCCGAAGGCTTCGAGGGCTAC
GTCGGCAACGGCAGCGGCGGCGGCGTGGCGTCCGGCCGGGTCGCCTACACCCTCGGCCTC
GAAGGCCCGGCCGTGACCGTGGACACCGCCTGCTCCTCCTCACTGGTCGCCCTGCACCTG
GCCTGCCAGGCGCTGCGGGCCGGCGAGTGCTCACTCGCCCTCGCGGGCGGGGTGACGGTG
ATGTCCACCCCCAGCCTGTTCGTCGAGTACTCCCGGCAGCGCGCGCTCGCGGCGGATGGC
CGGTGCAAGGCGTACGGGGCGGGGGCGGACGGCACCGGCTGGGCAGAAGGCGCCGGGATG
TTGCTGGTGGAACGGCTCACGGACGCACAGCGGCTCGGCCACCGGGTGCTGGCAGTGGTC
CGGGGCAGCGCGGTCAACCAGGACGGCGCGAGCAACGGCCTCACCGCCCCCAACGGCCCC
GCGCAGCAACGGGTCATCCGGCAGGCACTGGCGAGCGCCGGGGTGTCGGCGTCCGAGGTC
GACGCCGTGGAGGGGCATGGGACGGGGACGCGGCTGGGCGATCCGATCGAGGCGCAGGCG
TTGCTGGCGACCTACGGTCAGCAGCGGCCCGCGGACCGGCCGCTGTGGCTCGGGTCGATG
AAGTCCAACGTCGGCCATGCGCAGGCGGCCGCCGGCGTGGGCGGGATCATCAAGATGGTG
ATGGCCATGCGGAGCGGGACGCTGCCGCGCACCCTGCACGCGGACGAGCCGTCGCCGCAC
ATCGACTGGGACTCGGGCGCGGTGCGGCTGCTGACCGAGCCGGTCGCCTGGCCGGAGCGC
GACCGGCCGCGCCGCGCCGCGGTGTCCTCCTTCGGGGTCAGCGGCACCAACGCCCATGTG
ATCCTCGAGGCCGCGTCGCAGACGGCGCCGCACACGGAATCCGCGTCGCAGACGGAAACC
GACGACGCTCCCGCGCCGCACGGCGCGCCGGGCCATGCCGTGGCGGGGCCGCTGCCCTGG
CCCCTGTCGGGCGCGACGGCCGAGGCGCTGCGGGCCCAGGCCAGGGAGCTGCGTCGCTTC
GTGGCGGCCGATGAGCTGCTGCGCCCCGCCGACGTCGGGCACACCCTGGTCTTGGGCCGC
TCGGACCTCGCACACCGCGCAGTCGTCCTCGGCTCCGACCGGGAAACCCTGCTGCGCGGT
CTGGACACTCTGACAGGGGAGGGGCCGGACGGCGGCTCGGTCGTACGGGGCGTGGCGGCG
GCAGGGGCCGGTGCGGGCGTGGTGTTCGTCTTCCCGGGACAGGGCGGCCAGTGGGCCGGC
ATGGGGCTGCGGCTGCTGGAGACCTCGTCGTTCTTCGCCGAGCGGATGGCGGAGTGCGAG
GCGGCCTTGGCACCGTATGTCGACTGGTCGCTGCTCGACGTGCTGCGCCGGGACCCCGGG
GACCCGGTGTGGGAGCGGGCCGATGTCGTCCAGCCGATGCTGTTCTCGGTGATGGTGTCG
CTGGCGCAGCTGTGGCGCTCGTATGGCGTCGAACCGGACGCCGTACTCGGCCACTCCCAG
GGCGAGATCGCCGCCGCCCACATCTGCGGCGCGCTGACCCTGGACGACGCCGCGAAGGTT
GTCGCCCTGCGCAGCCGGGCCCTGCAGACCCTGCGCGGTTCGGGCGGCATGGCCTCCGTA
CCACTGACGGCGGACGAGGTCGCCGGGCTGCTGCGGACCGCATGGCCGGACCGGCTGTGG
GTGGCCGCCGTCAACGCCCCCACGGCCACGGTGATCTCCGGCGACGCGGACTCTCTGGCG
GAGGCGCTGGAACACTACCGGGACCAGGGCGTCGACGCGAAGCGGGTCCCGGTCGACTAC
GCCTCCCACTGCCCGCATATCGAGGCCGTGGAGCAGGAGCTGCTGAGCCTGTTGCGGGGG
ATCGCTCCAAGGGCCGCCGACATTCCCTTCTACTCCACTGTGGACAACCAGTGGGCCGAC
ACCATGGGACTCGACGCCCGGTACTGGTACCGCAATCTGCGCCGGCCCGTACGCTTCGCC
GAAGCGCTCCGCGCTCTCGGTGCCGCCGAGTACCGGTCGTATGTCGAGGTCGGCCCGCAC
CCCACCCTCACCCCCGCCATCGAGGACACCACTGAGGCCGCCGGCGCCGCGGCCACGGTT
GTCGGCTCCCTGCGCCGCGGCGAGGACGACGCCCACCGCATCCTCACCTCGCTGGCCCGG
GCTCATATTCATGGCCTGCCCGTGGCGTGGGACCGCCACTACCGGGCGCTCGCCCCCGAG
GCGAACCATGTCGACCTGCCCACCTACGCCTTCCAGCGCCGCCGCTACTGGCTGGACGCC
CCGGCGACCACCGGGGACGTGACGGCCGCGGGGCTGGCCCCGGTCGGACACCCACTGCTC
GGCGCGGCGGTCGGACTCGCCGAGGGCGACGGATATCTGCTCACCGGCCGGCTCGCCCCG
CACACCCACCCCTGGCTCACCGACCACGCGGTCGCCGGCACCGTCCTGCTGCCGGGCACC
GCATACGTGGAACTGGCCGTGCACGTCGGCGAACACCTCGGCTGCCCCCGGCTGGAGGAG
CTCACCCTGCACGCCCCGCTCGTCCTCCCCGACACGGGCGGTGTGGCGCTCCAGGTGGCC
GTCGGCGCACCGGACGAGACCGGCCGCCGCGCACTGAGCGTCTACGCACAGCGCGACGAC
GACCCCACGTGGGAAGGGGCGGCCCGGGGCGCGTGGACACGGCATGCGACCGGCACACTG
GCGGCCGAGGCCGCGACCGATGGCATCAACGGTGCCGACGGTGCCGGGCCCCTGGCGGGG
GCGTGGCCTCCGCCGGGCGCGGAGCCCCTGGACATCAGCGGCCTCTACGACACGCTGGCC
GCCGCGGACTTCGGCTACGGCCCGGCCTTCCAGGGGCTGCGCGCCGTCTGGCGGCACGGC
GAGGAGACCTACGCCGAGGTGCGGCTCCCCGACCAGGTGGCCGCCGACGCCCCACGCTTC
TGCCTCCACCCCGCGTTGCTCGACGCCGCGCTCCACCCGCTGGCACTCGACAGCGGCCGA
AGCGAGGAGAATCCAGCGGGACATGGCCTGCTGCCATTCGCCTGGCGCGGCGTCAGCCTG
CGCTCCCCGGGCACACCGACGCTGCGCGTACGGCTGCGGCCGCAGGGCCCGGACTCGATT
GCCGTCGACGTGGCCGACGAGACGGGCGCGTCGGTGGTCTCGGCCGAATCGCTCACGCTG
CGACCGGTGGCCCTGGAGGACCTGCGGGTCCTCGGCGGCCAGGCGAACGACCCCCTCTAT
GCCCTGGAGTGGACCGCCGCGCCCGAGCCCCTGACAACAGCCCTCGGGCGGTGCGCCGTG
CTTGGCCACGCCACCCCCGGATGGGCCGCCGCGTTGGAGACGGCGGCAGCGGAGCCCGTA
CGGCGGTACCCGGACCTTGCCGGACTGGTAGCGGCCCTGGACGCCGGCGATCCGCCTCCG
GACCTGGTGTTCGTGGGCTGCCCTCCGGCTGCCGCCGGGCCCGACGACACGACGGTCGCC
GACGTTCACACCACCCGTACCCGTGTCCGTACCCGACAAGCGCTGGAGCTGCTTCAAGGC
TGGCTCGGCGAAGCGCGGCTGGCCGGCGCGCGGCTGGTGCTGGTCACCCGCGGCGCGGTG
GCCACCGGGCCGGCGGGGGGAGGGATGGACCTGGCGGGCGCGGCGATCTGCGGACTGGTG
CGATCCGCACAGGCCGAGGAGCCCGATCGCATCCTCCTGGTGGACTTGGACACGGCCGAG
GAGTCGTGGGCGGCGCTGCCACGGGCGGTCGCGCTGGGCGAACCGCAGATGGCCATCCGG
GCCGGCCAGCCGCACATGGCCCGGCTGGTGCGAGCCGACACCGAGAGGGACGCCCTGCTC
ACGCCGCCACGGGGGAGCGGCGGCTGGCGGCTCGACTGCGCCGATGCGGGCACGCTCCAG
GGGTTGGCGCCGGTGGCGTCCTCGGCCGACCACGACCCGCTGGGCCCGCAGCAGGTACGG
ATCGAGGTGCGTGCGGCCGGGCTGAACTTCCGCGATGTCCTGGTGGCCCTGGGGATGGTC
CCTGGGCAGCAGGGGCTGGGCAGCGAGGGCGCCGGGGTGGTGCTCGAAGCCGGGCCTGAA
GTGGCCGACCTGGCGCCCGGAGACCGGGTGATGGGCGTGTTCGCGGACGCGTTCGGCCCG
TTCGCGATCGCCGACCGGGCCACAGTGATCCGCGTCCCCGAGCACTGGACCTTCGCCCAG
GCCGCCGCCGTCCCCGTCGTGTTCGCCACCGCCTACTACGGGCTGGTGGACCTGGCAGGA
CTGCGCCCGGGCGAGTCGGTGCTGGTGCACGCCGCGGCCGGCGGAGTGGGACTGGCCGCC
GTCCAACTGGCCCGCCACCTGGGCGCTGAGGTCTACGCCACGGCGAGCCCCGGCAAATGG
GACACCCTACGCGCCCACGGCATCCCCCCGGAGCGCATCGCCTCGTCCCGCACCCTCGAC
TTCGAGAGCCGGTTCACCGGCCGGAACATCGACGTCGTCCTCAACTCCCTGGCCCATGAG
TACGTCGACGCCTCGCTGCGCCTGGTGTCCGGCGACAGCGGCCGGTTCCTCGAGATGGGC
AAGACCGACCTCCGTGACCCGGAGGAGGTGGCGGAGGCGTACCCCGGTGTCGCCTACCGG
GCGTACGACCTGATGGAGGCCGGACCCGAGCGCATCGGGGAGATCCTGCGCACCGTGCTG
CGGCTGTTCGACGAGGGCGTGCTCACCCCGCTGCCGCTCACCTGCTGGGACATCCGGCAG
GCCAGGGATGCCTTCCGCCAACTCCAGCAGGGCCGCACCGTCGGAAAGAATGTGCTCACG
CTGGACCGCACCCCCGACCCCGACGGCACCGTCCTCATCACCGGTGGCACCGGCACCCTC
GGCGCCGCGCTCGCCCGCCATCTCGCCGCCACCGGCCGAGCACGGCATCTGCTGCTGATC
AGCCGCCGTGGCCTCGATGCGCCAGGCGCTCCCGAACTCATCGCTGAGATCGACGAGTTG
GGCGCGGCGACGACCGTCGCCACCTGCGACGTCGGCGACCGTGCCGCGCTCGCCGAACTG
CTCGGGCGGATCCCCGCCGAGCACCCGCTGACCGCCGTCGTCCACGCCGCGGGCACACTC
GACGACGCCACGCTCGGCTCCCTCACCGCGCGCCACCTCGACACCGTTCTGCCCGCGAAG
GCCGATGCCGCCTGGCATCTGCACGAGCTGACCTGCCGGCTGGATCTGGCCGCGTTCGTG
CTGTTCTCGTCCGCCGCGGGCGTCCTGGGCTCGCCGGGGCAGGGCAACTACGCCGCCGCC
AATGCCTTTCTCGACGCGCTCGCCTTCCAGCGACGGGCGATGGGACTCCCCGCCGTGTCC
CTGGCATGGGGACTGTGGGAGGAGGCCAGCGGGATGACCGGCCACCTCGACCAGACCGAC
CGCACCCGCATGGCCCGCGTCGGCCTCCGGCCACTGGCCACGAACGAGGCCCTGGCGCTG
TTCGACAACGCTCTCGTCGATGGCCCACCGCTGCTGCTCCCGGCCCGTATCGACACCAAG
GCGCTACGGGGCACCACCGCACCGCCCCTGTTCCAGAGCCTCGTACGTCCCACCACCGGC
CACCGGCCACGCCCCGCGACACCCGACGGCCGCTCCTCCCTCCGAGCCCGGCTCGCCGGG
CTCGACCCTGCCGCACAGCACGAGGTCCTGCTCACCCTCGTCCGCGGCCACGCCGCCACG
GTCCTCGGCCACCCGAGCCCCGACGCCATCGCCCCCGAGGCGGCCTTCCGTGACCTCGGC
TTCGACTCCCTCACCGCCGTAGAGCTCCGCAACCGCCTCAAGGAGGCAACCGGTCTGCGG
CTCCCCGCCACCCTCGTCTTCGACCACCCCACTCCTGCCGCTCTCGCCCAGCACCTGCGG
GACGGCCTCATCGGCGGCGCCGATGCGGCCACCTTGGCTTCGGCTCCTGCTCCGAGCGAG
GTGGCGACGGTGGCGGATGAGGCCATCGCGATCATCGGCATGGCCTGCCGGTATCCGGGG
GGCGTGCGGTCGGCCGAAGGGCTGTGGGATCTGGTCGCCTCCGGCACCGACGCCATGAGC
GGATTCCCCACCGACCGCGGCTGGGACCTCGACCGCCTCTACGCCCCCCAGGACCAGGAC
CGGCCGGGCACCACATACACCCGCCACGGGGGCTTCCTCCACGACGCGGGCAAGTTCGAC
GCGGGATTCTTCGGCATCGGCCCACGTGAGGCGCTGGCGATGGATCCACAGCAGCGGCTG
CTGCTGGAGACCTCCTGGGAGGTTTTCGAACACGCGGGAATCGACCCCTCGTCGGTACGG
CGGAGCCGGACCGGAGTCTTCGCCGGTGTGATGCCGACGGACTACGGCCCCCGGCTGCAA
GACACCGTGGCCGAGGTCGAGGGCTATGTCCTCACCGGAAACTCCGGCAGCGTCGCCTCG
GGCCGTATCGCCTACACCTTCGGTCTGGAAGGCCCCGCGGTGTCGGTGGACACGGCGTGT
TCGTCGTCTCTGGTGGCGTTGCATCTGGCGTGTCAGGCGCTGCGTGCGGGGGAGTGCTCC
ATGGCGCTGGCCGGCGGGGTGACGGTGATGGCGACGCCTGGTGCCTTCGTGGAGTTTGCG
CGGCAGCGGGGGTTGTCGGTGGATGGGCGGTGCAAGGCGTTTGGGGTGGGTGCGGATGGT
ACGGGGTGGGCGGAGGGGGTGGGGATGCTGTTGGTGGAGCGGTTGTCTGATGCGCGGCGG
TTGGGGCATCGGGTGTTGGCGGTGGTGCGGGGTTCTGCGGTGAATCAGGACGGGGCGAGC
AATGGTTTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATCCGGCAGGCGTTGGCC
AGTGCGCGGGTTGGTGGGGCGGATGTGGATGTGGTGGAGGGGCACGGTACGGGGACGCGG
CTGGGTGATCCGATCGAGGCGCAGGCGTTGCTGGCGACCTACGGTCAGGAGCGGTCGGGG
GATGAACCGTTGTGGTTGGGGTCGGTGAAGTCGAATATCGGGCATGCGCAGGCTGCGGCG
GGTGTTGCGGGTGTCATCAAGATGGTGATGGCGATGCGGTGTGGGGTGTTGCCGCGGACG
TTGCATGTGCAGGAGCCGTCGCCGCATGTGGACTGGTCCTCGGGTGGGGTGCGGCTGCTG
ACGGAGGCGGTGCCGTGGCCGGAGACGGGTCGTGCGCGGCGTGCGGGGGTGTCGTCGTTC
GGGGTCAGCGGCACCAACGCGCACATCATCCTCGAACAGGCACCGCCGGAGGAGCACGAC
GATCCGGCGGACGTTTCGTCCGGGTCGTTTCCGTGGATGGTGTCGGCCAAGTCCGAACAG
GCACTACAGGCACAGGCAGCGCAGCTGCGCGCGTATCTGGCGGCACGTCCCGGGGTGGGG
CTGGCTGATGTCGGGTATGCGCTGGCCGCCGGCCGTACCGCCTTCGACCACCGTGCCGTG
CTCCTGGGCCCGGACCGCGAAGCCTTCCTCGAAGGGCTGGGGGCTCTGGGGGCCGGTGAG
GAACACGCCGGGCTCGTACGGGGCGTGGCGACGGGTGCGGGGAAGCTGGCGTTCGTGTGT
TCCGGGCAGGGCACGCAGCGCCCTCGTATGGGGCACGAGCTGTACCGCGCCTTCCCGCTG
TTCGCCGCAGCCATGGACGAAGCCTGCGCATACCTGGACCCGCATCTCGACCGGCCTCTG
CGGGATGTCGTGTTCGCCGAGCCGGACTCCGGTACGGCCCGGCTGCTGCAGCAGACGCGC
TATGCCCAGCCCGCGCTGTTCGCCCTCCAGGTCGCCCTGCATCGCCTGGTCACCGAACAC
TACGGCCTCACGCCCCACTACTACGCGGGCCATTCCCTGGGGGAGATCACCGCGGCCCAC
CTCGCCGGGATCCTGACCCTCTGCGACGCGGCGCGTCTGGTCACCACCCGCGCCCGCCTG
ATGCAGTCTCTCCCCGCCACCGGCGCGATGACCACCCTCCAAGCAGACCCCGACGAACTC
CACGAACACCTCGCACGATGCGAGGGACGGGTGTCGCTCGCGGCCGTGAACGCGCCTGGG
TCCGTGGTCATCAGCGGTGACCGCCACGACGTAGACGCCACGGCCGAAAACTTCCGCGCC
ATGGGGCGCAAGACCACCCCGTTGAAGGTCAGCGGCGCCTTCCACTCACACCACATCGAC
CCACTCCTCGACGAACTCCGCGCCACCGCCGAAACCCTCACCTACCACCCACCCCACACC
CCCCTCATCACGACCGACCTGACCGACCAGGACCCCACCACACCTGGCTATTGGGTCCGG
CAAACACGCGAGACCGTCCACTACGCCCACACCACCCAACAACTCCACACCCACGGCGTC
ACCGCCTACCTCGAACTCGGCCCCGACACCACACTCACCACCCTCACCCACCACAACCTC
CCCCACCACACCCCCCTAGCCATCCCCCTCCTCCACCCCGACCAACCCGAAACCCACACC
ACCCACACCGCCCTCGCCCACCTCCACACCCACGGCCACCCCACCACCTGGCACCACCAC
CACACCCCCACCCACCACCACCCAAACCTCCCCACCTACCCCTTCCAACACCACCACTAC
TGGCTCAACACCACCACTGCCACCGGTGATATGTCGGCGGCAGGCCTTGAGCCGGCGCGG
CATCCCCTGTTGGGCGCGGCGGTCGAGTTGGCCGATGGTGAGGGGTTGCTGTTCACTGGG
CGGATTTCACTCCGTACGCATCCCTGGTTGGCCGACCACGCCGTCGGCGGCGCCGTGTTG
CTCCCCGGTACGGCCTTTCTCGAACTCGCCCTCGAAGCCGCCGCCCATGTCGACTGCCAT
CGGATCGAGGAGCTTACGCTCCACACCCCGCTCGTCGTACCGGAGAGCGGCGGCGTAGTG
CTGCAGGTGACCGTGGCCGGGCCGAACGAAGCAGGAAACCGGGCGGTGGATATCTACTCG
CGAATCGATGTCGGCGGCCTCACCGCCGATTCGGTGGGCGAGCCGTGGACGCGCCATGCC
GCCGGGTACCTTGCCGACAAGCCTGGCCCAGACTGCGGTGACTCGGCGGATGGTGTCATG
CCTGCGGGCGCATGGCCGCCGCCGGGTGCGGTCGCCGTGGATCTGGAGGAACTGTACGAG
CAGCTGGCCGAGGGGGGTTTCCACTACGGTGCGGCCTTCCGTTGCCTGGACGCCGCCTGG
CAACGCGGCGACGAGGTCTTCGCGACTGTGCATATGTCAGAGAATCAGCTGGGCGACACG
GCCGCGGCTCGGTTCGCGCTGCACCCCGCGCTGCTGGATTCCGCACTGCACACCATTCCA
CTCCTCCCCTCCCTGCAGGGACAACAGGACAGCGGGCTGCCGTTCACGTGGGCAGGAGTC
ACCCTGCGCGCATCCGGGGCCACGGCCCTGCGCGTCCGGCTGAGGCCGGATGGCCATGGC
CCGGGGGCGGTGTCCGTCGACGTGTCCGACGAGGCGGGTGAGCCCGTAGCATCAGTTCGG
TCGTTGGCCCTGCGGCCGGTGACCAGGGTCGAGTTGCATACGGCCGAGTTGCGCACAGCC
GCCCCAGTTGCCCCCCATAGCTCGCTCTTCGAGGTGCGATGGGAACCCGTCCCCCAGCCC
TCAGCGGCCGAAGAAGCCGATCCATGGGTGATGATCGGGACCGGACCGACGCTGCGCCCG
GACGAGGACTTCGCCACTCCGCCGGAGCGGACGTACGCCGACCTGGCCGCGCTGTGCGCG
GCAGTCGCCGATGGCGCGCCCGTTCCCCGGACGGTCGTGGCCTGGTCCCAGGCCGGGAGC
GAAGACGAGTCGAGTGAGGCGCTGCGCCACGCCACACACCACATGCTGGGCCTACTGCAG
CAGTGGTTGGCGGACAGCCGGTTCGTCGACAGTCGCCTGGTGATCCTCACCCGAGCCGCG
GTGGCCACTGCGCCGGAGGAGGAGGTAAAAGACCTGGCGGGAGCGGCGACGCGGGGTCTG
ATCCGCTCCGCCCAGTCGGAGCACCCCGACCGATTCGTCCTGCTCGACCTGGACGACCGT
CCCGCTGACGCGAAAGACCACGACCGAATGCTGTCGGTGGCCCTGGCCTGCGGGGAACCG
GAAGTGGCCGTACGCGATGGAGCCCTGCGCACACCCCGGCTGAGCCCGCTTGCCGGCACC
GCCACCGAGGCCATGGACGAGCATCCCTGGGATCCGGACGGCACCGTACTCATCACCGGC
GGCACCGGCAGCCTCGGCGCCATGCTCGCCCGCCACTTGGTGGCCACCCATGGCGTACGG
CATCTGCTGCTGATCAGCCGACGTGGCCTCGACGCCCCGGGGGCCAGGCGACAGGGGAAC
GAACTCGTCGAGCTCGGAGCGCAGTTGACCATCGCCGCGTGCGATGCCGCAGACCAAAGG
CAACTTGCAAACGCATTGTCGGAGATCTCCGTCGACCATCCGCTGACCGCTGTGGTGCAT
GCGGCAGGCGTACTGGACGACGGGGTGATCACATCCCTCACACCGGAGGACCTGACCCAT
GTCCTGCGGGCCAAGGTCGATTCGGCGCTCAATCTCCACCAGCTCACACGCGACCTGCCG
CTGTCCGCGTTTGTGCTCTTCTCCTCGCTGGCCGGGGTGATGGGTTCGGCAGGGCAGGGC
AACTACGCCGCCGCCAACGCCGCCCTGGACGCGCTGGCGAGTCACCGCAGGGCCACTCGG
CTGCCGGCGGTGTCCCTGGCCTGGGGAGTTTGGGAGCAGACCGAGGGCATGACCGGGCAG
TTGGAGGCCACGGGCCACGCGAGGCTCCGCCGCTCGGGCCTGAGGCCGCTGGCCACCAGC
GAGGGCCTGGAGCTCTTCGACAAGGCCTTGAGCTGTGGACACGCCCTGGTGGTGCCCGCC
GCACTCAGCACGAAGGAGCTTCAGACATCCGGATCCGTCCCACCATTCCTGCGCCACGTG
ACGGGCGTCGCTCCGGCCCGGCCGTCCCGGACCCGCGACGCCTCGGCCGGTGAGCCGACC
CCCCTGCGGCGGCGGTTGACCGGCCTCGGGCCGGAAGAGCGGCTACGCGAGGTGCTGCGG
CTGGTGCGCTCCCGGGCGGCTGCGGTGCTGGGGCACGGCACGGCCGAAGCGGTCCCGGCG
GACTCGGCGTTCCGCGACCTGGGGTTCGACTCCCTCGCCGCGGTGGACCTGCGGAACCGG
TTGCAGCAGGCCACCGGGCTGCGCCTGCCGGCCGGCTTGATCTTCGACCGGCCGCGTCCG
GACGTACTCGCCCGTTTCCTGTGTGACGAGTTGGCCGGTGTCGGCGGTACGTCGGCGGCC
ACGGCCGCCCCACCCGTTGCGGCCGTCGGCGGGGCAGCCGGCGAGCCGGTGGCCATCGTC
GGCATGGCATGCCGGTTTCCGGGAGGTGTGCGGTCGGCCGAGGGCCTGTGGGATCTGGTC
GCCTCCGGTATGGACGCGGTGGGTGACTTCCCCACAGACCGAGGCTGGGAGGTGGAACGG
CTCTACGACCCCGACCCGGACCGAACCGGCACCTCCTATACCCGGCAAGGCGGGTTCCTC
TACGACGCGGGTGAGTTCGACGCGGCGTTCTTCGGGATTGGCCCGCGTGAGGCGGTGGCG
ATGGATCCACAGCAGCGGCTGCTGCTGGAGATTTCCTGGGAGGCGCTGGAACGGGCGGGA
ATCGACCCGGCGTCGCTGCGGGGGAGTTCGACTGGAGTGTTCGCTGGGGTGATGTACCAC
GACTACGGCACCCGCTTGCGCGAGATCCCAGAGGGCTACGAGGGCTATATCGGCAATGGA
AACGCGGGCAGCGTCGCTTCGGGACGTGTCTCCTACACTTTCGGCCTGGAGGGGCCGGCG
GTCACCGTGGACACGGCGTGTTCGTCGTCCCTGGTCGCCCTGCATCTGGCCTGCCAGGCG
CTGCGGTCAGGGGAGTGCTCCATGGCGCTGGCGGGCGGGGTCACCGTCATGTCCACCCCC
ACCACTTTTGTCGAGTTCTCGCGCCAACGGGGACTGGCCCCGGACGGGCGGTGCAAGTCC
TTCGGGGCCGGCGCGGACGGAACGGGCTGGGCGGAGGGCGCGGGGATGCTCCTGGTGGAG
CGGCTTTCGGACGCCCGGCGCAACGGCCACCGGGTCCTGGCGGTGGTACGGGGGAGCGCG
GTCAACCAGGACGGGGCGAGCAATGGGCTGACGGCGCCGAACGGCCCGTCGCAAGAGCGG
GTGATCCGCCAGGCGTGGGCAAATGCGGGTGTGGCCGCGATGGACATCGACGCGGTGGAG
GGACACGGCACGGGGACGACGCTCGGTGACCCCATTGAGGCCCAGGCGCTGCTGGGGACG
TATGGACAGGGACGGTCGGCCGATCGGCCGTTGTGGTTGGGATCGATCAAGTCCAACGTC
GGACACACCCAGGCCGCCGCGGGGGTGGGCGGCGTCATCAAGATGGTGATGGCCATGCGC
CACGGGCTGCTCCCGCAGACCCTGCACGCCGAGGAGCCCTCACCTCATGTGGACTGGTCG
GGCGGGACGGTGCGGTTGCTGACCGAGCCGGTGGCCTGGCCTGAGCGGGGGCGGATGCGC
CGCGCAGGCGTCTCCTCTTTCGGTGTCAGCGGTACCAACGCCCACGTCATCTTGGAACAA
GCACCACCTAACGCGGAGACCCACGAACCGGCAGAGCCCCACACCGCGCCAGGCCCACTG
CCCTGGACGATCTCCGCGAAGAGCCCGCAAGCGCTACGTGCCCAGGCGCGTCAGTTGCAC
ACGTACCTGACCAACACCCCCGAGGCGAACCCCGCCGACGTCGGCCACACCCTCGCGATG
GGCCGCGCCTCTTTCGAGCATCGTGCGGTGGTTATCGGCTCCGATCGAGGGGAGTTTCTG
GGTGGTCTGGATGCTGTGGCGGCAGATGAGGCCCACTCTGCTGTGGTCACGGGTATCGCG
AGGAAGGCCGGTGACCTGGGGAAGGTGGTGTTCGTCTTCCCCGGGCAGGGTGGTCAGTGG
GCCGGGATGGGACTGCGGCTGCTCAAGACCTCGCCCGTCTTCGCGCAATCCATCCAGGCC
TGCGAACAAGCCCTCGCCCCCCACACCGACTGGACCCTGACCGACATCCTGCACCGCCCC
CACACCGACCCCCTGTGGCAGCGCGCCGACGTCATCCAGCCCGCCCTCTTCGCCCTCATG
ACCTCCCTCACCACCCTCTGGCAATCCCACGGCCTCAACCCCGACGCCGTCATCGGCCAC
TCCCAAGGCGAAATCACCGCCGCCCACGCCTGCGGAGCACTGAGCCTGGAAGACGCCGCG
AAAATCGTCGCCCTCCGCAGCCAGACCCTGCAAACCCTCCAAGGCTCAGGCGGCATGGCC
TCCGTACCACTGCCCGCAGACCAGGTCACCGCACTGCTGCACACCATGTGGCCCGACCAG
CTATGGGTCGCCGCCATCAACGCCCCCACCACCACAGTCATCTCCGGCGACACACAAGCC
CTCACACAAGCGCTGAACCACTACCGGGACCAAGACATCGACGCGAAACGCATCCCGGTC
GACTACGCCTCCCACTGCCCCCACATCCAGGCCGTCCAACACGAACTCTCAGACCTGTTG
CAGGACATCACCCCACGGGCCGCGACCACCCCCTTCTACTCCACCACCGACAACCAATGG
ACCGACACCACCACCCTCAACGCCCACTACTGGTACCGAAACCTCCGCCAACCCGTCCAC
CTCACCAACGCCATCACCAACCTCACCCACCAAGGCCACCACACCTACATCGAAATCAGC
CCCCACCCCACCCTCACCCCCGCCATCCAGGAAACCACCCACACCACCCACACCCCCACC
ACCGTCATCAGCACACTCCGCCGCAACCACAACGACACCCACCAACTCCTCCACGCCCTC
GCCCACGCCCACACCACCGGCCACCCCATCAACTGGCACCCCACCCACCAACACCACACC
CCAACCCCCCAACACACCGACCTCCCCACCTACCCCTTCCAACACCAACGCTACTGGCTC
AACACCCCCACCCAAACAGGAGACGCAGCAGCCATCGGCCTGGACCCGGCACATCACCCG
CTGCTCGGCGCGGCGGTCGCAGTGGCCGAGGGGGAGGGCTATCTGCTCACCGGTCGGCTC
GCCCTGTCCACCCACCCCTGGCTTGCCGATCACACCATCGCGGGCGCGGTCGTCCTTCCC
GGAACTGCCCTTCTTGAGATCGCCCTTCAGGCGGGCCATCGTGTGGACTGCCATCGCATC
GAAGAACTCACCCTCCAATCGCCGCTGTTCATCCCGGAAGAGGGAGCAGTACAGGTGCAG
GCATGGGTGGCGGCGCCGGATGAGAACGGGTACCGAAGCCTGACGGTGTCCTCCCGACGT
GAGGGTACGTACGAGGACGCCACGTGGGTGCGCCATGCCACGGGCCGGGTCGGTCCCGCA
CCGGCCGACCAGGATGATGCCATCGCGCGGCTCACCGACCCACAAGGCGACGGAGCGGCG
GCGGTCTGGCCACCGCAGGGCGCTGTCGCGTTCACAGCAGACGATCTGGAGGGCCTGTAC
GACGGGTACGCGGCGCGGGGATTCGAGTACGGCCCGGTGTTCCGAGGACTGCGGGCGGCC
TGGCGACGTGGCGAGGACATCTTCGCCGAGGTGCGCCTTCCCGACACGGCGGACGGCGAC
GCCTCCCAGTTCTCCGTACACCCCGCCCTGCTGGACGCCGCCCTGCACGCCGCCGCCTTC
CGCCCGGCCGACGAACTCCCGCACGGGGCTCTGCCCTTCTCCTTCAGCGGGGTGAGGCTG
CACGGGCCCGGAGCGTCGACCCTGCGGGTGCGCCTCACCCCGGATGGCCAGGCGCGGGAC
ACGCACGCATGGTCGGTCGCGGTGGTCGACGGCGAGGGGCGGCCGGTGGCCTCGATCGCG
TCGCTCGCGGTCCGCCCGGTGTCGACGCAGGAGTTGCTGGCGGCCTCCGGTACGGCGCGG
CGGGACTCGCTCTTCGCGGTCGAGTGGGTGACCGCCCCGGCGCCGACCTCGTCGTCCGCT
CCGCGACGCCTGGCCACGGTGGGGCCCAGCGACCGCCTCCCCTCGGCAGACGCGTACGCG
AACCTCGCCGACCTGGCCGCCGCAGTGCTGGAGGCGGAGGCCCCGGCGCCCGATGCGGTC
GTGGTCGACTGCGGCCGCCGCGACGCGCGCGCCACGGCCGTGGCGGAGGACGTACGGACC
CTCACCCGGCGCATCCTGGGTCTGCTGCAGGAGTGGCTGGCGGACGAGAGGCCGGCCTCG
AGCCGGATGGTCGTACTGACCCGTGGTGCGGTGGCCACCACACCGGGGGAGGACGTGGCG
GACCTGGCGGGCGCGGCGGTGTGCGGCATGGTGCGGTCCGCGCAGTCGGAACATCCCGGC
CGGTTCGTCCTGCTGGACCTCGACCCCGACCCGGACCTCGACGGCGGGGAAGTGCCACCG
ACCGTCGTACCGGCGGCTCTCGCCTGTGGTGAGCCGCAGATCGCGGTGCGTGCGAACCGG
CACCTGGTGCCCCGGCTGACCCGCGTTCCGGTGTCCGTCCCCGTCCCCGGGCCTGTTCCC
GTTCCCGCCGCCGAGGCAGCCGACCAGGACACCACGCCCACGGCGTTCGACCCCGACGGC
ACCGTACTGATCACCGGCGGCACCGGCACCCTCGGCGCGGTGCTCGCGCGCCATCTGGTC
AGCCGTCACGGCGTACGGCACCTGCTGCTGGCATCGCGACGCGGGCCCGACGCACCCGGC
GCCACCGAGCTGCGGGCGGAACTGGCCGAGCTCGGGGCCGAGGCGACGGTGCGCGCTTGT
GACACCGGTGACCGAGGCGCGCTGGCGGATCTCATCGCGGGGATTCCCACCGGCCACCCT
TTGACCGGTGTGGTCCACGCCGCGGGCGTCCTGGATGACGCCACCGTCGCCTCCCTCACC
CCCCGACACCTGGACACCGCGCTGACACCCAAGGCCGACGCCGCCTTCCATCTGCACGAG
CTCACCCGCCACGCCCGGCCGCGCGCCTTCGTCCTGTTCTCCTCGGCCGCCGGTGTCCTC
GGCGCAGCCGGGCAGGGCAACTACGCTGCCGCCAACGCCTTCCTCGACGCCCTCGCCGAA
CACCGCAGGGCGCAGGGCCTGCCGGCCTTGTCGCTCGCGTGGGGCTTGTGGGAGCAGGGC
AGCGGCATGACCGGGCATCTCGACCGCACCGACCGGGCCCGCATCAACCGCTCCGGACTC
GCCCCCCTCGCCACCGAGGACGCTCTCGCGCTCTTCGACGCCGCCCTCGCCGGCGATCGG
CCGTTCCTGGTGCCCGCCCGGCTGGACCTACGGGGTTCAAGCGCCGCCGAGACCCCGGCG
CCGCTGTTCTCCAGGATCGCCCCGGCTCGTACGACCCGGGGCCGTACCCCCGGCGCTGAG
GGCGCCGCTGACCTTCGTACCCGTCTCGCGGCCCAGGATGCCACCGAGCAGCGCGACACG
CTTCTCACGATCGTCCGCACCCACACCGCCGCCGTCCTGGGGCATGACACGGCTGCCGCC
GTGCGGCCGGACGCGGCCTTCCGTGAGCTGGGTTTCGACTCCCTCGCCGCCGTGGAACTC
CGTAACCGCCTTCAAACGACCACCGCCCTCACCCTGCCCGCGACCACCGTTTTCGACCAC
CCCACGCCCGCTGCCCTCGCCGATCATCTGCGTACTCAGCTCTGCCAGGACGCTCCGTCC
CCGGCGGCGGCCACGGCCATGGCGGCGATGGCGGAGCTGGCCAGGCTGGAGTCCGCCGTC
TCCGATTCGGCGGCGCTCGACGACGACACGCGCAGCGGCCTCGCGGAGCGCCTGCGGTCC
CTCGCCCGCAAGATGAGCAGTGGCCGTGTCGTCGACCACAACGGCGGCGGCGCTGCGGGC
CTGGATCTCCAGTCGGCCACGGACGATGAGATGTTCGAGCTGATCGACAAGGAGGTCAGC
CGAGACTGA
[7] KS39..414
[7] AT588..906
[7] methylmalonyl-CoA not conserved YASHS(S->C)780..784
[7] DH957..1133
[7] ER1477..1779
[7] KR1789..1969
[7] ACP2070..2140
[8] KS2167..2543
[8] AT2698..3013
[8] malonyl-CoA not conserved HAFHS(H->G)2892..2896
[8] DH3061..3236
[8] KR3574..3754
[8] ACP3858..3928
[9] KS3955..4330
[9] AT4490..4808
[9] methylmalonyl-CoA not conserved YASHS(S->C)4682..4686
[9] DH4859..5037
[9] KR5380..5560
[9] ACP5661..5731
[7] KS115..1242
[7] AT1762..2718
[7] methylmalonyl-CoA not conserved YASHS(S->C)2338..2352
[7] DH2869..3399
[7] ER4429..5337
[7] KR5365..5907
[7] ACP6208..6420
[8] KS6499..7629
[8] AT8092..9039
[8] malonyl-CoA not conserved HAFHS(H->G)8674..8688
[8] DH9181..9708
[8] KR10720..11262
[8] ACP11572..11784
[9] KS11863..12990
[9] AT13468..14424
[9] methylmalonyl-CoA not conserved YASHS(S->C)14044..14058
[9] DH14575..15111
[9] KR16138..16680
[9] ACP16981..17193

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [584-711]  G3DSA:3.40.366.10 [780-897]  G3DSA:3.40.366.10 [2689-2824]  G3DSA:3.40.366.10 [2892-3004]  G3DSA:3.40.366.10 [4486-4613]  G3DSA:3.40.366.10 [4682-4799]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1604-1625]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2098-2113]  PS00012 [3886-3901]  PS00012 [5689-5704]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2070-2140]  PS50075 [3858-3928]  PS50075 [5661-5731]  PS50075
PS50075   ACP_DOMAIN
 [2074-2139]  7.5e-15 PF00550 [3862-3927]  8.60000000000001e-09 PF00550 [5665-5730]  8.3e-13 PF00550
PF00550   PP-binding
 [2063-2183]  3.69999438558106e-31 SSF47336 [3851-3971]  2.800005042611e-26 SSF47336 [5653-5748]  1.20000117458134e-23 SSF47336
SSF47336   ACP_like
 [2068-2141]  7.59999999999998e-70 G3DSA:1.10.1200.10 [3857-3932]  7.59999999999998e-70 G3DSA:1.10.1200.10 [5658-5734]  7.59999999999998e-70 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [1490-1622]  2.10000267834031e-28 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1496-1552]  4.29999999999999e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1789-1968]  5.19999999999996e-61 PF08659 [3574-3753]  5.00000000000001e-60 PF08659 [5380-5559]  6.6999999999999e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [39-289]  5.59999999999999e-98 PF00109 [2167-2418]  2.50000000000001e-94 PF00109 [3955-4205]  2.90000000000003e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [297-414]  1.9e-45 PF02801 [2426-2543]  3.40000000000004e-47 PF02801 [4213-4330]  5.69999999999998e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [588-906]  1.20000000000001e-104 PF00698 [2698-3013]  6.09999999999996e-58 PF00698 [4490-4808]  3.60000000000002e-104 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [586-878]  5.7999965385478e-66 SSF52151 [2695-3009]  6.99997659850661e-61 SSF52151 [4488-4793]  4.19999771339582e-64 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [713-779]  1.59999889349252e-16 SSF55048 [2826-2891]  4.09999599045784e-17 SSF55048 [4615-4681]  9.69999663390112e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [41-301]  G3DSA:3.40.47.10 [302-467]  G3DSA:3.40.47.10 [2169-2430]  G3DSA:3.40.47.10 [2431-2597]  G3DSA:3.40.47.10 [3957-4217]  G3DSA:3.40.47.10 [4218-4384]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [31-467]  1.59998835313644e-101 SSF53901 [2159-2542]  6.90004508941104e-98 SSF53901 [3947-4329]  3.39999972437719e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1568-1753]  6.29999999999998e-48 G3DSA:3.40.50.720 [1789-2000]  2.99999999999998e-105 G3DSA:3.40.50.720 [3574-3791]  2.99999999999998e-105 G3DSA:3.40.50.720 [5380-5590]  2.99999999999998e-105 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [202-218]  PS00606 [2331-2347]  PS00606 [4118-4134]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [590-888]  1.19999063421924e-117 SM00827 [2699-2995]  1.39999277195148e-107 SM00827 [4492-4790]  3.99998544139406e-110 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2071-2143]  1.3000049540733e-37 SM00823 [3859-3931]  1.20000117458134e-28 SM00823 [5662-5734]  3.59998852907783e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [957-1133]  2.0000139277205e-82 SM00826 [3061-3236]  6.19996040581186e-81 SM00826 [4859-5037]  2.0000139277205e-73 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [41-467]  SM00825 [2169-2596]  SM00825 [3957-4383]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1789-1969]  2.69998997787809e-59 SM00822 [3574-3754]  2.19999900980707e-62 SM00822 [5380-5560]  2.80000504261099e-60 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1477-1779]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit