close all open/close all

CDS information : Meili_00320


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction99,015 / 96,121 / - [in whole cluster]
99,015 / 96,121 / - [in contig]
Locationcomplement(96121..99015) [in whole cluster]
complement(96121..99015) [in contig]
TypeCDS
Length2,895 bp (964 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)LuxR-family transcriptional regulator
Gene
Gene (GenBank)meiR
EC number
Keyword
Note
Note (GenBank)
  • similar to AveR
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)
Related Reference
ACC
Q9S0N8
NITE
Aver_00010
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [LuxR-family transcriptional regulator]
MLIDRSAHIELAEATLHESAAGDFRLLVAEGGPGCGKSEFLKRFLGIAAESGAVVLDAPG
LPCESGTPLGLVRRLAEHPALPDRTRERLRHAPSQDGPRAVERLCGALCALSASAPLVIA
VDDLHHADQASLRQLLHIAHHARSAKILLIGTESPSGMDSPYSGMERPYGTERPYGRERP
CGRGGDPLLGAELLRHPGFRRITLDPLGPESVARLAATLGDQPVDGRLGAECYALTGGNP
LLLRALLQDRWAVPDTGGRAPRPTAGGPFHQAVVACLARTGTPIRDVAGALAVLGPSATP
ALLSRLLGLDATAVDRALQVLELSGLTDGHRCRHPVVAAAALDHLDAADRRLLHERGALL
LHEQGARATEVADHLLAAQPTVPSWAVAVLRDAATQALVDDDAPAAIRYLDLACRACQEP
PQRAATRIALAAATWRVNPSAAEHHLGDTLADLHTGTPTGSDAALLVRLLISCGRLEEAG
RARARLQTADHPGNDPDNGPGPGPDPGAGPDTDTDGGAVRPSVVHPCPWPIASDESRPRP
PSDTAAPREPWDETPGPGAAAAVWGIPGSGTSEAAADEAERRLRACPLLDGTLAVVANAV
RTLLRAGRTADADEWCHRLLKEATARRSPGWRAEFLAILAEIALRKGVLTDAEECARQAL
ACLPGRGGSVLVGGPLACQVHAYTAMGRYDDATRVLHHPVPGALFQSVYGLAYLRARGHY
HLATDHCRAALGDFLAAGRMAQRWGLDHPAVLPWRTDSAQAFLRLGERTRAARMITEQLS
CAHLWSDPHTRGVSLRLRARVAAAPERPHLLTQAVEVLQRSGDRLELARALADLGAAYRS
VGESIRANNVRRRAWRMAEECGAKALCDAILPWQAMCGGDRPDLPGRDQGAGLSESEMRV
AILAANGNSNREIALQLCVTMSTVEQHLTRVYRKLRISRRQQLPKSLIGPVGTPATDRRE
LSSL
selected fasta
>putative LuxR family transcriptional regulator [LuxR-family transcriptional regulator]
ATGCTCATTGACCGGAGCGCTCACATAGAGCTGGCGGAAGCGACGCTTCATGAGAGTGCG
GCAGGCGATTTCCGGCTGCTGGTCGCCGAGGGCGGGCCGGGGTGCGGCAAAAGCGAATTC
CTGAAGCGGTTCCTGGGGATCGCGGCCGAATCCGGTGCCGTGGTCCTCGACGCGCCCGGC
CTGCCATGCGAGAGCGGCACCCCGCTCGGCCTCGTACGACGGCTGGCCGAGCACCCGGCG
CTGCCGGACCGGACCCGCGAGCGGCTGCGACACGCCCCGTCACAGGACGGGCCCCGGGCG
GTGGAGCGGCTGTGCGGGGCGCTGTGCGCGCTCTCCGCGTCCGCACCGCTGGTGATCGCG
GTCGACGATCTGCACCACGCGGACCAGGCGTCGCTCCGGCAGCTGCTGCATATCGCCCAC
CACGCTCGCTCGGCGAAGATCCTGCTGATCGGCACGGAGAGCCCGTCCGGCATGGACAGC
CCGTACAGCGGCATGGAGCGCCCGTACGGCACGGAGCGACCGTACGGTCGGGAGCGCCCT
TGCGGTCGAGGCGGCGACCCGCTGCTCGGCGCCGAACTGCTGCGCCACCCCGGTTTCCGA
CGCATCACGCTCGACCCGCTCGGCCCCGAAAGCGTGGCCAGGCTGGCCGCCACGCTCGGC
GACCAGCCGGTGGACGGCCGCCTCGGCGCCGAGTGCTACGCACTGACCGGCGGCAATCCG
CTGTTGCTGCGGGCCCTGCTGCAGGATCGGTGGGCGGTGCCGGACACCGGTGGCCGGGCG
CCTCGGCCCACCGCCGGGGGACCCTTCCACCAGGCGGTGGTGGCCTGCCTGGCCCGCACC
GGGACGCCCATCCGCGACGTCGCCGGCGCACTGGCCGTACTCGGGCCGTCCGCCACACCC
GCGCTGCTGAGCCGACTGCTGGGACTGGACGCGACAGCGGTCGACCGCGCCCTCCAGGTG
CTGGAGCTGAGCGGCCTGACGGATGGGCACCGCTGCCGGCACCCGGTCGTCGCGGCGGCA
GCTCTGGACCATCTGGATGCCGCCGACCGGCGGTTGCTGCACGAGCGCGGCGCCCTGCTG
CTGCACGAGCAGGGCGCCCGGGCCACCGAGGTCGCCGACCACCTGCTGGCCGCCCAGCCC
ACGGTCCCCTCCTGGGCTGTCGCCGTACTGCGCGACGCCGCCACCCAGGCCCTGGTCGAC
GACGACGCACCTGCGGCGATCAGGTATCTGGACCTCGCCTGCCGCGCCTGCCAGGAGCCG
CCCCAGCGGGCCGCGACCCGGATCGCGCTCGCCGCCGCCACCTGGCGGGTCAACCCCTCC
GCCGCCGAACACCACCTCGGTGACACGCTCGCCGACCTGCACACCGGCACGCCGACGGGC
AGTGACGCGGCCCTGCTCGTACGGCTGCTGATCAGCTGTGGCCGACTGGAGGAGGCGGGC
CGGGCACGGGCCCGGCTGCAGACGGCCGACCACCCCGGCAACGACCCTGACAACGGCCCC
GGACCGGGCCCGGACCCGGGCGCGGGCCCGGACACGGACACAGACGGGGGCGCGGTGCGG
CCGTCGGTGGTGCACCCGTGCCCCTGGCCCATCGCGTCCGACGAGAGCCGGCCGCGGCCC
CCGTCCGACACCGCCGCCCCCCGCGAGCCCTGGGACGAGACTCCCGGCCCCGGCGCGGCC
GCCGCCGTCTGGGGCATCCCCGGCTCCGGCACCAGCGAGGCCGCCGCGGACGAGGCCGAA
CGGCGGCTGCGCGCCTGCCCGCTGCTGGACGGCACGCTGGCGGTGGTGGCCAACGCCGTA
CGGACCCTGCTGCGGGCCGGCCGTACGGCCGATGCCGACGAGTGGTGCCACCGGCTGCTC
AAGGAGGCGACGGCCCGCCGCTCGCCCGGCTGGCGGGCGGAGTTCCTTGCCATCCTTGCC
GAGATCGCCCTGCGCAAGGGCGTGCTGACGGACGCCGAGGAGTGCGCCCGGCAAGCGCTG
GCCTGCCTGCCCGGCCGCGGTGGCAGTGTGCTCGTCGGAGGTCCGCTCGCCTGCCAGGTC
CATGCCTATACCGCCATGGGTCGGTACGATGACGCGACCCGTGTGCTGCACCACCCGGTG
CCGGGCGCGCTGTTCCAGAGCGTGTACGGCCTGGCGTATCTGCGCGCCCGCGGCCACTAC
CACCTGGCCACCGACCACTGCCGCGCCGCACTCGGCGACTTCCTGGCCGCCGGCCGTATG
GCACAGCGCTGGGGCCTGGACCACCCCGCCGTGCTGCCCTGGCGCACCGACAGCGCCCAG
GCGTTCCTGCGACTCGGCGAGCGCACCAGGGCGGCGCGGATGATCACGGAGCAGCTGTCC
TGTGCCCACCTGTGGAGCGATCCGCACACCCGTGGCGTCTCGCTCAGGCTCCGGGCCCGG
GTCGCCGCGGCGCCCGAGCGCCCGCATCTGCTCACCCAGGCAGTCGAGGTGCTGCAGCGG
TCCGGGGACCGGCTCGAACTCGCCCGGGCGCTGGCCGACTTGGGCGCCGCATACCGGAGC
GTCGGCGAGTCGATCAGGGCCAACAATGTGCGGCGCAGGGCGTGGCGGATGGCCGAGGAG
TGCGGCGCCAAGGCGCTGTGCGACGCCATTCTGCCCTGGCAGGCGATGTGCGGCGGGGAC
CGGCCGGACCTCCCTGGCCGTGACCAGGGAGCGGGACTGAGCGAGTCGGAAATGCGTGTG
GCCATCCTCGCCGCCAACGGCAACTCGAACCGTGAGATAGCGCTGCAGCTGTGCGTGACG
ATGAGCACGGTCGAACAGCATCTGACACGGGTGTACCGCAAGCTGCGCATCAGCCGCCGC
CAGCAACTGCCGAAGAGTCTGATCGGTCCGGTGGGGACACCGGCGACGGACCGCAGAGAG
CTGTCCTCGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [892-943]  7.79999999999999e-11 PF00196
PF00196   GerE
 [907-934]  PS00622
PS00622   HTH_LUXR_1
 [893-907]  1.10000029896148e-07 PR00038 [907-923]  1.10000029896148e-07 PR00038 [923-935]  1.10000029896148e-07 PR00038
PR00038   HTHLUXR
 [890-947]  3.60000433965927e-17 SM00421
SM00421   HTH_LUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [569-901]  8.00000000000001e-18 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [902-943]  7.59999999999999e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [871-949]  3.59999643435987e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit