close all open/close all

CDS information : Meili_00330


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction99,318 / 100,469 / + [in whole cluster]
99,318 / 100,469 / + [in contig]
Location99318..100469 [in whole cluster]
99318..100469 [in contig]
TypeCDS
Length1,152 bp (383 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf24

close this sectionSequence

selected fasta
>[hypothetical protein]
MIVIGHRDGLDQALQRRGLEPFYIVQAPVNTPAGRRFRRVIDMENAQEILRAVLSARLDD
VAGVLTVHEMGVFGAAYVRQQMDLPGNTDSAATLCFRDKYLQKSKLPPQIKRARCQYVSG
DISFADLAGDLGDTFVIKPATGAGALRTNIIRSPEEYARALKLFSGQSDVEIVAESFIDA
SEVYIDGIWQSGDLRWSSISRNHISPLSAVQGGVLAAHVLDRRRHSALFQQAETLARQAL
TGLNPPDCVFHLEAFTEESGLTFRECAIRLPGALSPQVNKLTFGVDLFDVEISLALGEEV
TEKLDSSAPDRFYGYLLLRRPKGGNLTQKDFERNFLFDEIQYSPDAPAGPYGRVGQAIVS
DPDELKLHQTMDDIVRFNEAGGA
selected fasta
>[hypothetical protein]
ATGATTGTCATCGGACATAGGGACGGTCTCGACCAAGCACTGCAGCGCCGAGGTTTGGAG
CCTTTCTATATCGTGCAGGCGCCGGTGAACACGCCGGCGGGTCGGCGGTTCAGGCGTGTC
ATCGACATGGAGAACGCCCAGGAAATATTGCGGGCAGTTCTCTCCGCTCGCCTTGATGAT
GTAGCAGGGGTGCTGACCGTCCATGAGATGGGCGTATTCGGGGCAGCGTACGTGCGGCAA
CAGATGGACCTCCCCGGGAATACGGACTCGGCGGCGACTCTCTGCTTCCGGGACAAGTAC
CTACAGAAGAGCAAGTTGCCGCCTCAGATCAAGCGAGCGCGCTGCCAGTACGTATCCGGG
GATATTTCGTTCGCGGATCTCGCCGGCGATCTCGGGGATACGTTCGTAATCAAGCCGGCA
ACCGGGGCCGGCGCCCTCCGTACGAACATCATCCGCTCGCCGGAGGAGTATGCGCGGGCC
TTGAAGCTGTTCTCAGGCCAGTCAGATGTCGAAATCGTCGCCGAGTCCTTCATTGACGCC
TCGGAAGTCTATATCGACGGCATCTGGCAGAGCGGCGACCTCCGGTGGTCATCCATCAGC
CGTAACCACATTTCACCGCTCAGTGCCGTGCAGGGCGGCGTCCTGGCCGCGCATGTGCTG
GACAGAAGACGACATTCCGCACTCTTCCAGCAAGCAGAGACACTTGCCAGGCAGGCGCTC
ACCGGCCTGAACCCGCCCGATTGCGTCTTCCATCTGGAAGCATTCACGGAAGAATCGGGG
CTGACTTTTAGGGAGTGTGCCATCCGTCTCCCAGGGGCGCTGTCTCCCCAGGTCAATAAG
TTGACATTCGGCGTCGATCTCTTTGACGTCGAGATCAGCCTGGCGCTCGGGGAAGAGGTG
ACCGAAAAACTGGACAGCAGTGCGCCGGACCGCTTCTACGGGTATCTACTTCTACGTCGT
CCCAAAGGCGGAAACCTGACCCAGAAGGATTTCGAGCGCAACTTCCTCTTCGATGAGATC
CAATATTCACCCGACGCACCGGCCGGACCGTACGGCCGCGTCGGACAGGCCATCGTCTCC
GACCCGGATGAGCTGAAACTGCACCAGACGATGGACGACATCGTGCGATTCAACGAGGCC
GGCGGCGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011761 ATP-grasp fold (Domain)
 [98-296]  PS50975
PS50975   ATP_GRASP
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [124-179]  9.50000000000001e-06 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   ATP_grasp_subdomain_1
SignalP No significant hit
TMHMM No significant hit