close all open/close all

CDS information : Meili_00340


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction100,671 / 102,113 / + [in whole cluster]
100,671 / 102,113 / + [in contig]
Location100671..102113 [in whole cluster]
100671..102113 [in contig]
TypeCDS
Length1,443 bp (480 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)beta-lactamase-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf25

close this sectionSequence

selected fasta
>[beta-lactamase-like protein]
MPERDASVRTEAGGRVMAGGPRPSAALPEDLEVVQLATLSLGNRSYLITDGTVAVAVDPQ
RDIERITAVLDSRAWRLGAVVETHVHNDYVTGGLELARHSDAVYVVPAGPELGFDTVRTG
DGDEIPAGDLSIQVIATPGHTDHHVAYAFALRGGVPRLVCTGGSVLYGTTGRTDLMGAGM
AEPLARRQYRSARHLAEVLPDDTVLLPTHGFGSFCAASTAGAVERSTIGRERAINPVFTL
DEDAFVSSALSGLEPYPTYYRRMATINAGGPTPLADLGTPRSADLTELADRVAAGEWVVD
VRPRAEFAHTHLRGTVNIDARGSLATYLGWLVPFGAPLTLLAADDEQLEAVRTELLRIGF
DHPAAVATGNPLEWAGPRWLTSYPRADFITLAAALAGRPMEILDVRNGGEWRRGHLPGAR
HIPLPELPHTLAALPDTEIWVHCHSGFRAAIAASLLAAAGRQVVLVDDAFEHAAPMTRGQ
selected fasta
>[beta-lactamase-like protein]
GTGCCGGAGCGCGATGCCTCGGTCCGGACCGAGGCGGGCGGTCGGGTCATGGCCGGCGGG
CCGCGGCCGTCGGCGGCACTGCCCGAAGATCTGGAAGTCGTCCAGCTCGCGACGCTCAGC
CTCGGCAATCGCAGCTATCTGATCACGGATGGCACGGTCGCGGTGGCGGTGGACCCTCAG
CGTGACATCGAGCGGATCACCGCCGTGCTGGACTCGCGGGCGTGGCGGCTCGGCGCGGTG
GTGGAGACCCATGTGCACAACGACTACGTCACGGGCGGTCTGGAACTGGCCCGCCACTCG
GACGCGGTCTACGTGGTGCCGGCCGGTCCCGAGCTGGGCTTCGACACCGTACGGACGGGC
GACGGGGACGAGATCCCGGCCGGGGACTTGAGCATCCAGGTGATCGCCACGCCCGGGCAC
ACCGACCATCACGTGGCATATGCGTTCGCACTCCGTGGTGGCGTGCCGCGGCTCGTCTGC
ACCGGAGGGTCGGTGCTGTACGGGACGACCGGGCGCACCGATCTGATGGGGGCGGGGATG
GCCGAGCCACTGGCCCGTCGGCAGTACCGGTCGGCCCGCCATCTCGCCGAGGTGCTGCCC
GATGACACCGTGCTCCTGCCGACCCATGGCTTCGGGAGCTTCTGTGCGGCGTCGACGGCC
GGCGCGGTCGAGCGTTCGACGATCGGCCGCGAACGTGCCATCAATCCCGTCTTCACGCTG
GACGAGGACGCCTTCGTCTCCAGCGCCTTGTCCGGCCTCGAGCCCTACCCCACGTACTAC
CGGCGGATGGCCACGATCAATGCCGGCGGGCCGACACCCCTGGCCGACCTCGGCACCCCC
CGCTCCGCCGACCTGACCGAGTTGGCCGACCGCGTGGCGGCCGGGGAGTGGGTGGTGGAT
GTACGGCCACGCGCGGAATTCGCGCACACCCATCTGCGAGGCACCGTGAACATCGACGCC
CGCGGGTCCCTCGCCACCTATCTGGGCTGGCTGGTGCCGTTCGGTGCCCCGCTCACCTTG
CTGGCGGCCGACGACGAACAGCTGGAAGCCGTCAGGACGGAGCTCCTACGGATCGGCTTC
GACCATCCCGCGGCCGTCGCCACCGGAAACCCGCTGGAATGGGCGGGCCCACGATGGCTG
ACTTCCTACCCGCGCGCGGACTTCATCACCCTGGCCGCCGCCCTGGCCGGACGGCCGATG
GAAATCCTGGACGTCAGGAACGGCGGCGAGTGGCGTCGCGGGCATCTGCCCGGCGCCCGG
CACATACCGCTGCCCGAACTGCCCCACACCCTTGCTGCCCTGCCGGACACCGAGATCTGG
GTGCACTGCCACAGCGGCTTCCGGGCCGCGATCGCGGCCTCCCTGCTGGCCGCCGCGGGC
CGCCAGGTCGTACTCGTCGACGACGCCTTCGAGCACGCCGCGCCCATGACACGAGGGCAG
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [42-209]  7.40000780398342e-17 SM00849
SM00849   Lactamase_B
 [42-209]  1.1e-10 PF00753
PF00753   Lactamase_B
IPR001763 Rhodanese-like domain (Domain)
 [386-479]  3.0999994589937e-11 SM00450
SM00450   RHOD
 [398-466]  3.2e-08 PF00581
PF00581   Rhodanese
 [248-374]  3.50000235434314e-13 SSF52821 [380-468]  3.60000433965927e-23 SSF52821
SSF52821   Rhodanese-like
 [275-330]  1.9e-24 G3DSA:3.40.250.10 [387-469]  4.9e-25 G3DSA:3.40.250.10
G3DSA:3.40.250.10   Rhodanese-like
 [396-478]  PS50206
PS50206   RHODANESE_3
SignalP
 [1-36]  0.051 Signal
Eukaryota   
 [1-26]  0.195 Signal
Bacteria, Gram-negative   
TMHMM No significant hit