close all open/close all

CDS information : Meili_00350


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction103,669 / 102,173 / - [in whole cluster]
103,669 / 102,173 / - [in contig]
Locationcomplement(102173..103669) [in whole cluster]
complement(102173..103669) [in contig]
TypeCDS
Length1,497 bp (498 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Na+/solute symporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf26

close this sectionSequence

selected fasta
>[Na+/solute symporter]
MIALAVIFAFLLAALGLGLRARRGRDMDLEQWSVGGRGFGTVFVFLLLAGEIYTTFTFLG
ASGWAYGKGAPAYYILCYASLAYVLSYWLLPAVWRYAKQHRLISQSDFFVAKYNSPLLGA
LVALVGVVAMVPYLVLQLKGLGIIVSVSSDGRISSHWAIVIGTVALTLYVTISGIHGSAW
TSVLKDTAILAVVLILGIYLPMHYFGGIGEMFRAVDQAHPNTLTLPSSGMSTSWFASTVL
LSAVGFYMWPHTFSASYSAQNERVFRRNAIFMPLYQLILLFVFFVGFTAILVVPGLKGAD
ADLSLLRITTATFPSWFVGIVGGAGLLTALVPGSLLLMSSATCLAKNVYRIARPHTSDKH
IGRLAQLLVPALALISLYFTFNGGSSIVSLLLMGYALVTQLFPALLASLAPRQIVTKQGA
AAGIVVGVTTVAVVTLSGVTVGSLLPGLPQAVKDLNVGVIALVLNAVTMAAVSAVTRTAS
PATAVSLRPESEATAGTG
selected fasta
>[Na+/solute symporter]
ATGATCGCCCTCGCCGTCATCTTTGCCTTCCTCCTCGCGGCCCTGGGCCTGGGCCTGCGC
GCCCGCCGCGGCAGGGACATGGATCTCGAACAGTGGTCGGTGGGCGGCCGCGGCTTCGGG
ACGGTCTTCGTCTTCCTGCTGCTGGCCGGCGAGATCTACACGACCTTCACCTTCCTGGGC
GCCTCGGGATGGGCCTACGGCAAGGGCGCACCCGCCTACTACATCCTCTGTTACGCCTCA
CTGGCCTACGTCCTGTCGTACTGGCTGCTGCCGGCCGTATGGCGCTACGCCAAGCAGCAC
CGGCTGATCTCGCAGTCCGACTTCTTCGTCGCCAAATACAACAGCCCGCTGCTCGGCGCG
CTGGTGGCCCTCGTCGGAGTCGTCGCGATGGTGCCCTACCTCGTGCTGCAGCTGAAGGGG
CTGGGGATCATCGTGTCCGTCTCCTCCGACGGCCGTATCTCCTCCCACTGGGCCATCGTG
ATCGGCACGGTGGCGCTGACCCTGTACGTGACCATCTCGGGCATCCACGGCTCGGCCTGG
ACCTCGGTGCTCAAGGACACCGCCATCCTCGCGGTCGTGCTGATTCTGGGCATCTACCTG
CCGATGCACTACTTCGGCGGCATCGGCGAGATGTTCCGGGCAGTGGACCAGGCCCATCCC
AACACCCTCACCCTGCCCTCGAGCGGCATGAGCACATCGTGGTTCGCCTCCACCGTGCTG
CTGTCGGCGGTCGGCTTCTACATGTGGCCGCACACGTTCAGCGCCTCCTACAGCGCCCAG
AACGAACGCGTCTTCCGCCGCAACGCCATCTTCATGCCGCTCTACCAACTCATCCTGCTC
TTCGTCTTCTTCGTCGGCTTCACCGCCATCCTGGTCGTGCCCGGCCTCAAGGGCGCCGAC
GCGGACCTGTCCCTGCTGCGCATCACCACCGCCACCTTCCCCTCGTGGTTCGTCGGCATC
GTCGGTGGCGCCGGACTGCTCACCGCGCTGGTCCCCGGGTCCCTGCTGCTCATGAGCTCC
GCGACCTGCCTGGCGAAGAACGTCTACCGAATCGCCCGGCCCCACACCAGCGACAAGCAC
ATCGGCCGTCTCGCCCAGCTGCTCGTGCCCGCCCTCGCCCTGATCTCCCTCTACTTCACC
TTCAACGGCGGCAGCTCGATCGTGTCGCTGCTGCTCATGGGCTACGCGCTGGTCACCCAG
CTCTTCCCGGCCCTGCTGGCGAGCCTCGCGCCACGGCAGATCGTCACCAAACAGGGAGCG
GCCGCGGGCATCGTCGTCGGCGTCACCACGGTAGCCGTCGTCACCCTCTCCGGCGTCACG
GTGGGCAGCCTGCTGCCGGGGCTGCCGCAGGCGGTGAAGGACCTCAACGTAGGTGTCATC
GCCCTCGTCCTCAACGCCGTGACGATGGCCGCCGTCTCCGCCGTCACCCGCACCGCGAGC
CCAGCCACCGCCGTCAGCCTCCGGCCCGAATCCGAAGCCACGGCCGGCACCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001734 Sodium/solute symporter (Family)
 [34-427]  8.20000000000001e-16 PF00474
PF00474   SSF
 [1-441]  PS50283
PS50283   NA_SOLUT_SYMP_3
SignalP
 [1-18]  0.998 Signal
Eukaryota   
 [1-21]  0.514 Signal
Bacteria, Gram-negative   
 [1-21]  0.546 Signal
Bacteria, Gram-positive   
TMHMM
 [4-21]  Transmembrane (o-i) [34-56]  Transmembrane (i-o) [71-93]  Transmembrane (o-i) [113-135]  Transmembrane (i-o) [155-177]  Transmembrane (o-i) [189-211]  Transmembrane (i-o) [231-253]  Transmembrane (o-i) [274-296]  Transmembrane (i-o) [316-338]  Transmembrane (o-i) [359-381]  Transmembrane (i-o) [386-408]  Transmembrane (o-i) [420-442]  Transmembrane (i-o) [457-476]  Transmembrane (o-i)
Transmembrane 13