close all open/close all

CDS information : Meili_00360


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction103,896 / 103,666 / - [in whole cluster]
103,896 / 103,666 / - [in contig]
Locationcomplement(103666..103896) [in whole cluster]
complement(103666..103896) [in contig]
TypeCDS
Length231 bp (76 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf27

close this sectionSequence

selected fasta
>[hypothetical protein]
MYGPAQEVLDVKPIHLLGAIPFIGILGGIFFANRVTPYVLGMPFILFWLVMWVVLISVTM
AVIYRLDPANREEQNS
selected fasta
>[hypothetical protein]
GTGTACGGCCCGGCCCAGGAGGTTCTCGACGTGAAACCCATCCATCTGCTCGGCGCGATC
CCGTTCATCGGGATCCTCGGCGGGATCTTCTTTGCGAACCGGGTGACGCCCTACGTCCTC
GGTATGCCGTTCATCCTCTTCTGGCTGGTCATGTGGGTCGTACTGATCTCCGTAACCATG
GCCGTCATCTACCGTCTGGACCCGGCGAACCGGGAGGAGCAGAACTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR021741 Protein of unknown function DUF3311 (Family)
 [16-72]  1.6e-22 PF11755
PF11755   DUF3311
SignalP
 [1-61]  0.559 Signal
Eukaryota   
TMHMM
 [13-32]  Transmembrane (i-o) [42-64]  Transmembrane (o-i)
Transmembrane 2