close all open/close all

CDS information : Meili_00370


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction104,276 / 104,656 / + [in whole cluster]
104,276 / 104,656 / + [in contig]
Location104276..104656 [in whole cluster]
104276..104656 [in contig]
TypeCDS
Length381 bp (126 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf28

close this sectionSequence

selected fasta
>[hypothetical protein]
MFLNGQAMEGGPFHHHLRGAPLVARTRTASGYRFFSIRDTCPGLLPDPGVDTAMAGEVYD
VPDEVLRDHLLPSEPPELEFGIIRLEDGSSSFSMVLRRGELEKGIHKEITAFGGWRPYLK
SLGREN
selected fasta
>[hypothetical protein]
ATGTTCCTCAACGGTCAGGCGATGGAGGGCGGCCCCTTCCATCACCACCTGCGCGGAGCC
CCGCTCGTGGCGCGGACCCGTACCGCTTCCGGCTACCGCTTCTTCTCGATCCGGGACACC
TGCCCCGGGCTGCTGCCCGACCCCGGCGTCGACACCGCGATGGCCGGCGAGGTCTACGAC
GTCCCCGATGAGGTGCTGCGCGACCATCTGCTGCCCTCCGAGCCGCCGGAGCTGGAGTTC
GGCATCATCCGGCTCGAGGACGGTTCGTCGTCCTTCTCGATGGTTCTTCGCCGTGGCGAG
CTGGAGAAGGGCATCCACAAGGAGATCACCGCCTTCGGCGGCTGGCGTCCGTACCTCAAG
AGCCTCGGCCGGGAGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013024 Butirosin biosynthesis, BtrG-like (Domain)
 [6-67]  5.59999999999999e-09 G3DSA:3.10.490.10
G3DSA:3.10.490.10   Butirosin_synth_BtrG-like
SignalP No significant hit
TMHMM No significant hit