close all open/close all

CDS information : Meili_00380


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction104,656 / 105,486 / + [in whole cluster]
104,656 / 105,486 / + [in contig]
Location104656..105486 [in whole cluster]
104656..105486 [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hydroxypyruvate isomerase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf29

close this sectionSequence

selected fasta
>[hydroxypyruvate isomerase]
MNHRLPYTVNASILFTELPLLERPAAAKAAGFDAVEFWWPYPTAVPTDAEVDAFVRAVRD
AGVRLTGLNFFAGDMPGGDRGLVSWPARAAEFRDNIDVTVAIGEQLGCRSFNALYGNRLD
GVAPAHQDDLAVEHLALAAKAVERIGGTVLVEPVSGAPAYPLRTAADALAVIDRVVAESG
SRNLRLLADLYHLAVNGDDVAAVIAAHADRIGHVQIADAPGRGAPGTGGLDLDGLLADLR
TVGYAGWVGLEYKSEGPTADSFDWLPRERRGSDRHA
selected fasta
>[hydroxypyruvate isomerase]
ATGAACCACCGACTTCCCTACACCGTCAATGCGTCGATCCTCTTCACCGAACTGCCGCTG
CTGGAGCGTCCGGCCGCCGCGAAGGCCGCCGGGTTCGACGCGGTCGAGTTCTGGTGGCCC
TACCCGACGGCCGTGCCGACGGATGCGGAGGTCGACGCCTTCGTCCGGGCGGTGCGTGAC
GCCGGTGTCCGGCTGACCGGGCTGAACTTCTTCGCCGGGGACATGCCCGGAGGCGATCGT
GGCCTGGTGTCCTGGCCGGCCCGGGCAGCGGAGTTCCGCGACAACATCGACGTCACCGTG
GCGATCGGGGAGCAACTGGGCTGCCGGTCGTTCAACGCCCTGTACGGCAACCGGCTCGAC
GGCGTCGCACCGGCGCACCAGGACGACCTCGCGGTGGAGCATCTGGCGCTGGCGGCCAAG
GCCGTCGAGCGCATCGGCGGCACGGTCCTGGTGGAGCCGGTCAGCGGCGCCCCCGCGTAT
CCGCTGCGCACCGCCGCGGACGCGCTCGCCGTCATCGACCGGGTGGTGGCCGAGTCCGGC
AGCCGCAACCTCCGCCTCCTGGCCGACCTCTACCACCTCGCCGTCAACGGAGACGACGTG
GCCGCTGTCATCGCCGCCCACGCCGACCGCATCGGACACGTACAGATCGCGGACGCGCCC
GGGCGGGGAGCGCCCGGTACGGGAGGGCTGGACCTCGACGGGCTGCTGGCCGACCTCCGG
ACCGTGGGCTACGCCGGCTGGGTGGGCCTGGAGTACAAGTCCGAGGGCCCGACCGCGGAC
AGCTTCGACTGGCTACCGCGCGAACGGCGCGGCAGCGACCGCCACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012307 Xylose isomerase, TIM barrel domain (Domain)
 [25-229]  3.2e-31 PF01261
PF01261   AP_endonuc_2
IPR013022 Xylose isomerase-like, TIM barrel domain (Domain)
 [4-271]  2.69998997787809e-63 SSF51658
SSF51658   Xyl_isomerase-like_TIM-brl
 [8-265]  1.20000000000001e-75 G3DSA:3.20.20.150
G3DSA:3.20.20.150   Xyl_isomerase-like_TIM-brl
IPR026040 Hydroxypyruvate isomerase-like (Family)
 [3-272]  4.69998262513189e-87 PIRSF006241
PIRSF006241   HyI
SignalP
 [1-29]  0.435 Signal
Bacteria, Gram-positive   
TMHMM No significant hit