close all open/close all

CDS information : Meili_00390


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction105,556 / 106,452 / + [in whole cluster]
105,556 / 106,452 / + [in contig]
Location105556..106452 [in whole cluster]
105556..106452 [in contig]
TypeCDS
Length897 bp (298 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)2-hydroxy-3-oxopropionate reductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf30

close this sectionSequence

selected fasta
>[2-hydroxy-3-oxopropionate reductase]
MSATSRKIAFIGLGIMGGPMAANLVRAGHTVTGHNRSRAATDTLVAAGGRGADSIAEAVS
DAEVVITMVPADQQVKEVVLGEGGVLEHAAPGTLLIDMSSITPQTSLEVAAAARDKGLRT
LDAPVSGGEAGAIEGVLSIMVGGDPDDFADAGPVFEALGTTIVHVGPHGAGQTVKAANQL
MVAIHLQALAEAVVFLENAGVDLEAALEVLGGGLAGSTVLARKRDAVLSRDFKPGFRIDL
HHKDMGIVTDAARAVSAPLPVGAVVAQLVASARACGDGGLDHSALLRGVERLAGRDPR
selected fasta
>[2-hydroxy-3-oxopropionate reductase]
ATGAGTGCCACTTCCCGGAAGATCGCCTTCATCGGCCTGGGCATCATGGGCGGCCCGATG
GCCGCCAACCTGGTACGGGCCGGACACACCGTCACCGGACACAACCGCAGCCGTGCCGCC
ACCGACACCCTGGTCGCGGCCGGTGGCCGGGGCGCCGACAGCATCGCCGAGGCGGTGTCC
GACGCCGAGGTCGTGATCACGATGGTCCCGGCCGATCAGCAGGTGAAGGAGGTCGTCCTC
GGCGAGGGCGGCGTCCTGGAACACGCCGCGCCCGGCACCCTGCTGATCGACATGAGCAGC
ATCACCCCGCAGACCTCGCTGGAGGTGGCGGCTGCCGCGCGGGACAAGGGCCTGCGTACG
CTCGACGCCCCGGTGTCCGGCGGCGAGGCGGGCGCCATCGAGGGCGTGCTGTCCATCATG
GTCGGCGGCGATCCGGACGACTTCGCCGACGCCGGGCCGGTGTTCGAGGCGCTCGGCACC
ACCATCGTGCATGTGGGCCCGCATGGGGCTGGACAGACGGTCAAGGCCGCCAACCAGCTG
ATGGTCGCCATCCACCTCCAGGCGCTGGCCGAGGCCGTGGTGTTCCTGGAGAACGCCGGA
GTGGACCTGGAGGCGGCGCTGGAAGTCCTCGGTGGCGGCCTCGCCGGCTCCACCGTCCTG
GCCCGTAAGCGGGACGCGGTGCTCAGCCGTGACTTCAAGCCCGGATTCCGGATCGATCTG
CACCACAAGGACATGGGCATCGTCACCGACGCCGCACGTGCGGTGAGTGCGCCGCTGCCC
GTGGGAGCCGTGGTCGCCCAGCTGGTCGCCTCGGCCCGTGCCTGCGGCGACGGCGGCCTT
GACCACTCCGCGCTGCTGCGCGGGGTGGAGCGGCTGGCCGGCCGCGACCCGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002204 3-hydroxyisobutyrate dehydrogenase-related, conserved site (Conserved_site)
 [10-23]  PS00895
PS00895   3_HYDROXYISOBUT_DH
IPR006115 6-phosphogluconate dehydrogenase, NADP-binding (Domain)
 [6-167]  6.19999999999994e-55 PF03446
PF03446   NAD_binding_2
IPR006398 2-hydroxy-3-oxopropionate reductase (Family)
 [7-294]  3.19999999999996e-123 TIGR01505
TIGR01505   Tartro_sem_red
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [168-298]  5.59999989417026e-37 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [169-294]  8.70000000000003e-41 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR015815 Hydroxy monocarboxylic acid anion dehydrogenase, HIBADH-type (Family)
 [1-297]  5.79999653854781e-102 PIRSF000103
PIRSF000103   HIBADH
IPR016040 NAD(P)-binding domain (Domain)
 [5-167]  5.79999999999997e-60 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-27]  0.934 Signal
Eukaryota   
 [1-27]  0.979 Signal
Bacteria, Gram-positive   
 [1-21]  0.965 Signal
Bacteria, Gram-negative   
TMHMM No significant hit