close all open/close all

CDS information : Meili_00400


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction106,518 / 108,287 / + [in whole cluster]
106,518 / 108,287 / + [in contig]
Location106518..108287 [in whole cluster]
106518..108287 [in contig]
TypeCDS
Length1,770 bp (589 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)glyoxylate carboligase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf31

close this sectionSequence

selected fasta
>[glyoxylate carboligase]
MTAAQAAVEILKREGTTHVFGLPGAAINPFYSAMRMNGGLTHVLARHVEGASHMAEGYTR
ARAGNIGVCVGTSGPAGTDMITGLYSASADSIPILCITGQAPVAKLHKEDFQAVDIASIA
APLTKMAMTVLEPAQVPGAFQQAFHLMRSGRPGPVLIDLPIDVQMAEIEFDPETYEPLPV
YKPSATRAQIDKAVELLQAAERPLIVAGGGVINADASELLVEFAQLTGVPVVPTLMGWGS
IPDDHPLMAGMVGLQTSHRYGNATLLESDFVLGIGNRWANRHTGGLDTYTQGRTFVHVDI
EPTQIGRVFAPHLGIVSDAKPALELFVQAARELRAAGVLRDRGDWADSCRQRKGTLLRRT
HFDEMPVKPQRVYEEMNKAFGRDTRYVSTIGLSQIQAAQLLHVYRPRHWINAGQAGPLGW
TVPAALGVATAEPDATVVALSGDYDFQFMIEELAVGAQFRIPYLHVVVNNAYLGLIRQAQ
RGFDMDYCVQLSFDNINAPEVGGYGVDHVKVAEGLGCKAIRVFEPDRIAPALEEAKKLMA
EHRVPVVVEVILERVTNVSMGTELDNITEFEELATSPGHAPTALRMAQG
selected fasta
>[glyoxylate carboligase]
ATGACCGCGGCCCAGGCGGCGGTGGAGATCCTCAAGCGTGAGGGCACCACCCATGTCTTC
GGCCTGCCCGGTGCGGCGATCAATCCGTTCTACTCCGCGATGAGAATGAACGGTGGCCTG
ACCCATGTCCTCGCCCGGCATGTGGAGGGCGCCTCACACATGGCCGAGGGCTACACCCGA
GCCAGGGCCGGGAACATCGGGGTCTGCGTGGGCACCAGCGGCCCCGCGGGCACCGACATG
ATCACCGGGCTGTACTCGGCGAGCGCCGATTCGATCCCGATCCTGTGCATCACCGGCCAG
GCGCCGGTGGCCAAGCTGCACAAGGAGGACTTCCAGGCCGTCGACATCGCCTCGATCGCG
GCGCCGCTGACCAAGATGGCGATGACCGTTCTCGAACCCGCCCAGGTGCCCGGCGCGTTC
CAGCAGGCCTTCCACCTCATGCGCTCGGGCCGGCCCGGGCCGGTACTGATCGATCTGCCC
ATCGATGTCCAGATGGCCGAGATCGAGTTCGACCCGGAAACGTACGAGCCGCTGCCGGTG
TACAAGCCGTCGGCCACCCGAGCGCAGATCGACAAGGCCGTCGAACTGCTCCAGGCCGCC
GAGCGGCCGCTGATCGTCGCCGGGGGCGGGGTCATCAACGCCGACGCGAGCGAGCTGCTG
GTGGAGTTCGCCCAGCTGACCGGGGTGCCGGTGGTGCCCACACTGATGGGCTGGGGCAGC
ATCCCGGACGACCACCCCCTCATGGCGGGCATGGTGGGTCTGCAGACCTCGCACCGCTAC
GGCAACGCCACGCTTCTGGAGTCCGACTTCGTCCTCGGCATCGGCAACCGCTGGGCCAAC
CGCCACACCGGCGGCCTCGACACGTACACCCAGGGCCGCACCTTCGTCCACGTCGACATC
GAACCCACCCAGATCGGCCGGGTCTTCGCCCCGCACCTGGGCATCGTCTCCGACGCCAAG
CCCGCACTGGAACTGTTCGTCCAGGCGGCGAGGGAGCTGAGGGCCGCCGGAGTCCTCAGG
GACCGCGGCGACTGGGCCGACAGCTGCCGGCAGCGCAAGGGCACCCTGCTCCGCAGGACC
CACTTCGACGAGATGCCGGTCAAGCCGCAGCGGGTCTACGAGGAGATGAACAAGGCCTTC
GGACGCGATACGCGCTACGTCTCCACGATCGGGCTCTCCCAGATCCAGGCCGCGCAGCTG
CTCCATGTCTACCGTCCCCGGCACTGGATCAACGCCGGTCAGGCCGGACCGCTGGGCTGG
ACCGTGCCCGCCGCCCTGGGGGTCGCGACGGCCGAGCCGGACGCCACCGTCGTCGCCCTC
TCCGGCGACTACGACTTCCAGTTCATGATCGAGGAACTTGCCGTCGGTGCCCAGTTCCGC
ATCCCCTACCTCCATGTGGTGGTCAACAACGCCTACCTCGGGCTGATCCGGCAGGCCCAG
CGCGGCTTCGACATGGACTACTGCGTCCAGCTGTCCTTCGACAACATCAACGCCCCCGAG
GTGGGCGGCTACGGCGTCGACCACGTCAAGGTCGCCGAAGGACTGGGTTGCAAGGCCATC
CGCGTCTTCGAGCCCGACCGCATCGCACCCGCTCTGGAAGAGGCCAAGAAGCTGATGGCC
GAGCACCGGGTGCCGGTGGTCGTCGAGGTCATCCTCGAACGCGTCACCAACGTCTCGATG
GGCACCGAACTGGACAACATCACCGAGTTCGAGGAGCTGGCCACCAGCCCCGGCCACGCC
CCGACGGCGCTCCGCATGGCCCAGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006397 Glyoxylate carboligase (Family)
 [1-586]  TIGR01504
TIGR01504   Glyox_carbo_lig
IPR011766 Thiamine pyrophosphate enzyme, C-terminal TPP-binding (Domain)
 [390-550]  8.60000000000005e-35 PF02775
PF02775   TPP_enzyme_C
IPR012000 Thiamine pyrophosphate enzyme, central domain (Domain)
 [190-324]  2.99999999999998e-35 PF00205
PF00205   TPP_enzyme_M
IPR012001 Thiamine pyrophosphate enzyme, N-terminal TPP-binding domain (Domain)
 [1-170]  2.50000000000001e-52 PF02776
PF02776   TPP_enzyme_N
SignalP No significant hit
TMHMM No significant hit