close all open/close all

CDS information : Meili_00410


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction109,508 / 108,318 / - [in whole cluster]
109,508 / 108,318 / - [in contig]
Locationcomplement(108318..109508) [in whole cluster]
complement(108318..109508) [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)mandelate racemase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf32

close this sectionSequence

selected fasta
>[mandelate racemase]
MSIAPSESVVFKPWASAPGEATTDRIESVRLSLVNLPLHAPISDAKVLTGRQKPLTEIAF
LFAEIRTEGGHEGLGFSYSKRAGGPAIYAHAKEIASELIGEDPSDTGRLWSKLVWAGASM
GRSGVAVQGIAALDIALWDLKARRAGLPLAKLLGAHRDSVDVYNTSGGYLSMPIKEVLEN
IDLARARGVGGIKLKVGSPDPSVDLKRVEAVREHLGDDVPLMVDANQQWDRITATRVGRV
LENFNLTWIEEPLDAYDAEGHAALAATLDTPIATGEMLTSVGEHAALIEAGSSDFVQPDA
PRVGGITPFLQIAALADHKGRALAPHFVMEIHLHLSAAYPRTAWVEHFEWLEPMFNERLE
LKDGRMIIPNRAGLGLSLSEQAAAWTTESAVFGSGA
selected fasta
>[mandelate racemase]
ATGAGCATCGCCCCCAGCGAGTCGGTCGTCTTCAAGCCGTGGGCGTCCGCCCCGGGCGAG
GCGACCACCGACCGTATCGAGTCGGTCCGCCTCTCCCTCGTCAATCTGCCCCTCCACGCG
CCCATCAGCGACGCCAAGGTATTGACCGGCCGCCAGAAGCCGCTCACCGAGATCGCCTTC
CTCTTCGCCGAGATCAGGACCGAAGGCGGCCATGAGGGCCTGGGCTTCAGCTACTCCAAG
CGCGCGGGCGGACCCGCCATCTACGCCCACGCCAAGGAGATCGCCTCCGAGCTGATCGGC
GAGGACCCGAGCGACACCGGCAGGCTGTGGAGCAAGCTGGTGTGGGCCGGCGCCTCCATG
GGGCGCAGCGGTGTGGCCGTCCAGGGCATCGCGGCCCTCGACATCGCTCTGTGGGACCTC
AAGGCGCGGCGGGCGGGTCTGCCGCTCGCCAAACTGCTGGGCGCACACCGCGACTCGGTG
GACGTCTACAACACGAGCGGCGGCTATCTGTCGATGCCGATCAAGGAGGTGTTGGAGAAC
ATCGACCTGGCCCGGGCCCGTGGCGTCGGCGGCATCAAGCTCAAGGTCGGCTCGCCGGAC
CCGTCGGTCGACCTCAAGCGCGTCGAGGCGGTGCGGGAACACCTCGGCGACGACGTTCCG
CTGATGGTCGACGCCAACCAGCAGTGGGACCGGATCACCGCGACCCGGGTCGGCCGTGTT
CTGGAGAACTTCAACCTCACGTGGATCGAGGAACCGCTCGACGCGTACGACGCCGAGGGG
CACGCGGCCCTCGCGGCCACGCTCGACACCCCCATCGCCACCGGTGAGATGCTGACCAGC
GTGGGCGAACACGCGGCGCTCATCGAGGCGGGATCGTCCGACTTCGTCCAGCCCGACGCG
CCCCGGGTGGGCGGCATCACCCCGTTCCTGCAGATCGCGGCGCTCGCCGACCACAAGGGC
CGGGCTCTCGCGCCGCACTTCGTGATGGAGATCCACCTCCACCTGTCCGCGGCCTATCCG
CGTACGGCGTGGGTGGAGCACTTCGAATGGCTCGAGCCGATGTTCAACGAGCGCCTTGAA
CTCAAGGACGGCCGCATGATCATCCCGAACCGGGCCGGACTCGGCCTCTCCCTCAGCGAG
CAGGCGGCCGCATGGACCACGGAGTCGGCGGTGTTCGGCAGCGGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013341 Mandelate racemase/muconate lactonizing enzyme, N-terminal (Domain)
 [58-154]  2.9e-12 PF02746
PF02746   MR_MLE_N
IPR013342 Mandelate racemase/muconate lactonizing enzyme, C-terminal (Domain)
 [174-271]  2.800005042611e-28 SM00922
SM00922   MR_MLE
 [207-275]  1.3e-20 PF01188
PF01188   MR_MLE
IPR018110 Mandelate racemase/muconate lactonizing enzyme, conserved site (Conserved_site)
 [221-252]  PS00909
PS00909   MR_MLE_2
SignalP No significant hit
TMHMM No significant hit