close all open/close all

CDS information : Meili_00420


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction110,284 / 109,505 / - [in whole cluster]
110,284 / 109,505 / - [in contig]
Locationcomplement(109505..110284) [in whole cluster]
complement(109505..110284) [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)5-carboxymethyl-2-hydroxymuconate delta-isomerase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf33

close this sectionSequence

selected fasta
>[5-carboxymethyl-2-hydroxymuconate delta-isomerase]
MPVLPHRPGTIFGIGLNYLDTITEMGWPRPKAPYLFTKLSSSAIGTGEAIAIDAAVTRRV
DWETELAVVIGAEARDIPEDKALDVVFGYTVANDVSARDLQADDGQWVRGKGLDTFCPLG
PVVVTADEIKDPQALAVRTWVNGEKVQDGTTADMLFSVRSLIAYLSRFFTLRPGDVILTG
TPSGCGDFMDPPRALRPGDTVMSEVEGIGRLVNPVRVAGEQGAPDRSTADPPSPADRAST
QASTQASMQSSIQAFRSTS
selected fasta
>[5-carboxymethyl-2-hydroxymuconate delta-isomerase]
GTGCCCGTACTGCCCCACCGGCCCGGCACGATCTTCGGAATCGGCCTCAACTACCTCGAC
ACCATCACCGAGATGGGCTGGCCGCGCCCCAAAGCGCCGTATCTCTTCACCAAACTCTCC
TCCAGCGCCATTGGCACCGGCGAGGCCATCGCCATAGACGCCGCGGTCACCCGGCGCGTC
GACTGGGAGACCGAACTCGCGGTCGTCATCGGTGCCGAGGCCCGCGACATCCCCGAGGAC
AAGGCGCTCGATGTCGTGTTCGGCTACACCGTCGCCAATGACGTATCGGCCCGCGATCTT
CAGGCCGACGACGGCCAGTGGGTGCGCGGCAAGGGACTCGACACCTTCTGCCCGCTCGGC
CCCGTCGTCGTCACAGCCGACGAGATCAAGGATCCGCAGGCGCTCGCCGTACGGACGTGG
GTCAACGGAGAGAAGGTGCAGGACGGCACCACCGCCGACATGCTCTTCTCGGTCCGCTCG
CTCATCGCCTACCTCAGCCGCTTCTTCACGCTCCGGCCTGGCGATGTGATCCTCACCGGA
ACCCCCTCGGGATGCGGTGACTTCATGGACCCGCCGCGCGCCCTGCGCCCCGGGGACACG
GTGATGTCGGAGGTGGAGGGCATCGGCCGCCTCGTCAACCCGGTTCGGGTGGCGGGGGAG
CAGGGCGCACCGGACCGTTCCACCGCCGATCCGCCCTCGCCCGCGGATCGAGCATCGACG
CAGGCCTCAACGCAGGCATCAATGCAGTCATCAATTCAGGCATTCAGGAGCACCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002529 Fumarylacetoacetase, C-terminal (Domain)
 [11-216]  3.19999999999996e-69 PF01557
PF01557   FAA_hydrolase
IPR011234 Fumarylacetoacetase, C-terminal-related (Domain)
 [4-216]  1.10000000000001e-85 G3DSA:3.90.850.10
G3DSA:3.90.850.10   Fumarylacetoacetase_C-rel
 [3-216]  3.30001976117415e-75 SSF56529
SSF56529   Fumarylacetoacetase_C-rel
SignalP No significant hit
TMHMM No significant hit