close all open/close all

CDS information : Meili_00430


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction111,825 / 110,464 / - [in whole cluster]
111,825 / 110,464 / - [in contig]
Locationcomplement(110464..111825) [in whole cluster]
complement(110464..111825) [in contig]
TypeCDS
Length1,362 bp (453 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)anion/cation symporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf34

close this sectionSequence

selected fasta
>[anion/cation symporter]
MTRSKATPLSSAVAKIMRRVIPLFAIMMMCNQLNRSNIGYAESHLEADLGIGATAYGLGA
GLFFIAYFIFEVPSNLLMKRFGPKIWLSRICVSWGIVSACMLFAQGPTSFYVLRFLLGMA
EAGFVPAVLYYLATWLPNAYRGRANARYAVGALVAFSLSGPLSGPLLGMDGTLGLRGWQW
MFLVEGAMSVAIGVFAFFRLDSRIEDARWLNADEKRELTAAIDAEDAAYLNRHGDDRPTF
WSVLRDPKILLFVFVYFSVQMSIYANTFWLPSIVRDIKGTNDVTVGLLSSVPWVFAMAAM
FVLARIGDRTDRRKPLLIGALVAAAVGSYLAAVASPWLALVMLTVAAMGFKSISPIFWPI
VQRTVHPMVIGVAIAVINSIANLGGFVAPYGFGVVKQQTGSTQWGLIGLAVFSLIAALAS
FLIRENEDENPGLSRKKESAKAAQQVPAPQLRN
selected fasta
>[anion/cation symporter]
ATGACACGCTCAAAAGCGACACCCCTCTCCAGTGCCGTCGCCAAGATCATGCGCAGAGTC
ATTCCGCTGTTCGCCATCATGATGATGTGCAATCAGCTCAACCGCTCCAATATCGGCTAC
GCGGAAAGCCATCTCGAAGCCGATCTGGGAATAGGCGCCACCGCCTATGGACTCGGTGCG
GGACTCTTCTTCATCGCCTACTTCATCTTCGAGGTGCCGAGCAATCTGCTGATGAAGCGA
TTCGGTCCCAAGATATGGCTGTCCAGAATCTGCGTCAGTTGGGGCATCGTCTCGGCGTGC
ATGCTCTTCGCACAAGGACCCACCAGCTTCTACGTTCTGCGGTTCCTTCTCGGTATGGCC
GAAGCCGGCTTCGTACCCGCCGTTCTGTACTACCTGGCGACCTGGCTGCCCAACGCCTAC
CGGGGCCGGGCCAACGCCCGGTACGCCGTCGGCGCGCTCGTGGCGTTCTCCCTCTCAGGC
CCCCTGTCGGGTCCGCTGCTGGGGATGGACGGCACCCTCGGACTCCGGGGCTGGCAGTGG
ATGTTCCTGGTCGAAGGGGCCATGTCGGTCGCCATCGGCGTCTTCGCCTTCTTCCGTCTC
GACTCCCGGATCGAGGATGCGCGCTGGCTCAACGCCGACGAGAAGCGCGAGCTCACCGCC
GCCATCGACGCGGAGGACGCGGCGTATCTGAACCGGCACGGCGATGACCGCCCGACTTTC
TGGTCCGTACTGCGCGACCCCAAGATCCTGCTGTTCGTCTTCGTCTACTTCTCGGTCCAG
ATGTCGATCTACGCCAACACCTTCTGGCTGCCGTCGATCGTCCGGGACATCAAGGGCACC
AACGACGTCACCGTGGGCCTGCTCTCCTCCGTGCCGTGGGTCTTCGCCATGGCCGCCATG
TTCGTGCTCGCCCGGATCGGAGACCGCACCGACCGGCGCAAGCCGCTGCTCATCGGAGCC
CTCGTCGCCGCGGCCGTCGGCTCCTACCTCGCCGCCGTCGCCTCCCCCTGGCTCGCCCTG
GTGATGCTCACGGTCGCCGCCATGGGCTTCAAGAGCATCAGCCCCATCTTCTGGCCCATC
GTCCAGCGCACCGTCCACCCGATGGTGATCGGCGTCGCCATCGCCGTCATCAACTCGATA
GCGAATCTCGGTGGGTTTGTCGCACCCTACGGATTCGGGGTCGTCAAACAGCAGACGGGG
AGCACGCAGTGGGGTCTGATCGGCCTCGCCGTCTTCTCTCTCATCGCCGCACTCGCCTCC
TTTCTCATCCGTGAGAACGAGGACGAGAACCCTGGCCTCTCCCGGAAAAAGGAATCCGCA
AAGGCCGCACAGCAAGTACCCGCACCTCAGCTGAGAAATTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [25-389]  2.89999999999999e-49 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-439]  4.99996518094122e-90 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [20-428]  PS50850
PS50850   MFS
SignalP
 [1-25]  0.578 Signal
Bacteria, Gram-positive   
TMHMM
 [50-72]  Transmembrane (o-i) [85-107]  Transmembrane (i-o) [111-133]  Transmembrane (o-i) [146-168]  Transmembrane (i-o) [178-200]  Transmembrane (o-i) [249-271]  Transmembrane (i-o) [281-303]  Transmembrane (o-i) [316-335]  Transmembrane (i-o) [339-361]  Transmembrane (o-i) [368-390]  Transmembrane (i-o) [400-422]  Transmembrane (o-i)
Transmembrane 11