close all open/close all

CDS information : Meili_00440


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction112,100 / 112,885 / + [in whole cluster]
112,100 / 112,885 / + [in contig]
Location112100..112885 [in whole cluster]
112100..112885 [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)dimethylmenaquinone methyltransferase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf35

close this sectionSequence

selected fasta
>[dimethylmenaquinone methyltransferase]
MSPDASAPLDGAVFDQLGQVSTATLATQLYKRGIRQPFLVGLSPVGGGFDGFVGEAFTMR
FIPSREDTDPVGDPYRTGNVLQWEAVESLGPRQVMVVDSRNDTSAASAGDMLVTRAMKRG
AAGFVTDGAFRDGAAIAELGFPAYARATTATTRPAAFHVADLNVPIACAGVAVYPGDILV
GDRDGVIVVPRSLAAEIAEPSVEQELLEGWLQQRVRDGQPLWGTYPPSAETLKEYEEWKS
ARQEHQENAERPEHQTQEARA
selected fasta
>[dimethylmenaquinone methyltransferase]
GTGTCCCCAGACGCATCGGCGCCCTTGGACGGCGCCGTCTTCGACCAACTCGGCCAGGTG
AGCACCGCGACCCTCGCCACCCAGCTGTACAAACGCGGGATACGACAGCCGTTCCTCGTC
GGCCTCTCCCCCGTCGGCGGGGGTTTCGACGGCTTCGTGGGCGAGGCGTTCACCATGCGC
TTCATCCCGTCCCGCGAGGACACCGACCCGGTGGGTGACCCCTACCGGACCGGAAATGTC
CTTCAGTGGGAGGCGGTGGAGAGCCTGGGCCCTCGCCAGGTGATGGTCGTCGACAGCCGG
AACGACACTTCGGCGGCGTCGGCCGGCGACATGCTCGTGACGCGGGCCATGAAGCGCGGC
GCCGCCGGCTTCGTCACCGACGGCGCCTTCCGTGACGGCGCCGCGATCGCCGAACTCGGC
TTCCCGGCCTATGCGCGTGCCACCACGGCCACCACCCGGCCCGCGGCGTTCCATGTCGCC
GACCTCAATGTGCCCATCGCCTGCGCGGGGGTCGCGGTCTACCCGGGAGACATCCTCGTG
GGCGACCGCGACGGGGTCATCGTCGTGCCGAGGTCCCTCGCGGCGGAGATCGCCGAGCCC
TCCGTCGAGCAGGAGCTGCTGGAGGGGTGGCTCCAGCAGCGGGTGCGGGACGGGCAGCCG
CTGTGGGGCACCTACCCGCCCAGCGCCGAGACCTTGAAGGAATACGAGGAGTGGAAGTCC
GCCCGCCAAGAACACCAGGAAAACGCAGAACGCCCGGAACACCAGACCCAGGAGGCCCGC
GCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005493 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (Domain)
 [35-188]  1.3e-27 PF03737
PF03737   Methyltransf_6
 [19-196]  1.9e-45 G3DSA:3.50.30.40
G3DSA:3.50.30.40   RNaseE_inh/diMeMenaQ_MeTrfase
 [18-200]  3.29999077503323e-40 SSF89562
SSF89562   RNaseE_inh/diMeMenaQ_MeTrfase
SignalP No significant hit
TMHMM No significant hit