close all open/close all

CDS information : Meili_00450


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction112,882 / 113,391 / + [in whole cluster]
112,882 / 113,391 / + [in contig]
Location112882..113391 [in whole cluster]
112882..113391 [in contig]
TypeCDS
Length510 bp (169 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf36

close this sectionSequence

selected fasta
>[hypothetical protein]
MSRFADLPPAAQRARMESTIRTYFDGCNEADVAKMAAQFTPDAVHYFPPGLEGPWVGNTT
IAENWRRLVLTIGSAWSIERLVVEPETFQAVIEWTHWKTRPGGYLRGDEWYRFDPDTGLI
TEIRAFYASASDGRSEVTLQGYDYAAGGHHMEPPVKRPHPDAEYAATEH
selected fasta
>[hypothetical protein]
ATGAGCCGGTTCGCCGATCTTCCCCCGGCCGCGCAACGCGCCCGGATGGAGTCCACGATC
CGTACGTACTTCGACGGCTGCAACGAGGCCGACGTGGCCAAGATGGCCGCCCAGTTCACC
CCCGACGCCGTCCACTACTTCCCGCCCGGTCTGGAAGGGCCGTGGGTCGGCAACACGACG
ATCGCCGAGAACTGGCGCCGGCTGGTCCTCACCATCGGCTCAGCCTGGTCCATCGAGCGC
CTCGTCGTCGAGCCCGAGACCTTCCAGGCCGTCATCGAGTGGACGCACTGGAAGACCAGG
CCCGGTGGTTACCTCCGGGGTGACGAGTGGTACCGCTTCGACCCCGATACGGGCTTGATC
ACCGAGATCCGCGCCTTCTACGCCTCGGCGTCCGACGGGCGTTCCGAGGTGACGCTCCAG
GGCTACGACTACGCCGCGGGCGGCCACCACATGGAGCCACCCGTGAAGCGCCCCCATCCC
GATGCCGAATACGCCGCCACCGAACACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [20-123]  3.3e-10 PF12680
PF12680   SnoaL_2
SignalP No significant hit
TMHMM No significant hit