close all open/close all

CDS information : Meili_00460


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction113,420 / 114,931 / + [in whole cluster]
113,420 / 114,931 / + [in contig]
Location113420..114931 [in whole cluster]
113420..114931 [in contig]
TypeCDS
Length1,512 bp (503 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)aldehyde dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf37

close this sectionSequence

selected fasta
>[aldehyde dehydrogenase]
MNVIQSIDPSTGRAVDDVATATTPKELDAVVERATAASVPYEAGGRPLRAAVLRAVADGL
EARRPEIVALAMRETALPEARLGGELTRTVYQARLFAEVVEDGGFLEATIDHAGETPMGA
GPDLRRMLVPLGPVAVFGASNFPLAFSVPGGDTVSALAAGCPVVVKAHDSHPALSRLVFE
TMVAAIAAAGGPDGLLGLVFGREAGTALVAHPAIKAVGFTGSLTGGRALLDIAGARPDPI
PFYGELAGLNPVVVTEGAARARHSEIAAGLVASVTGSAGQLCTKPGLVLVPAGEAGNALV
AEAARLIDQASAATLLGSRIATAYEAGTEELRHRAGGMAAAEGGAPSGSGFSVTPRLFEI
DSETLQDEPVGECFGPAAVVVRYAPGRAEAVLRSLPASLTGTIHAEADETETVRRLTDVL
RPLAGRLLYNGFPTGVLVSWAQHHGGPWPSTNSLHTSVGPYAVRRFLRPVTWQNAPQEVL
PEELRDGFAGIPRRIEGRLTAPD
selected fasta
>[aldehyde dehydrogenase]
GTGAACGTCATACAGAGCATCGACCCGAGCACCGGCCGCGCCGTCGACGACGTCGCGACC
GCGACCACCCCCAAGGAGCTCGACGCCGTCGTCGAACGCGCCACCGCCGCATCCGTTCCG
TACGAGGCCGGTGGCCGCCCGCTGCGTGCCGCGGTCCTGCGGGCCGTCGCCGACGGGCTG
GAAGCCCGGCGGCCGGAGATCGTCGCCCTCGCGATGCGGGAGACCGCGCTGCCCGAGGCG
CGTCTTGGCGGCGAGCTGACCCGCACCGTCTACCAGGCCCGTCTGTTCGCAGAGGTCGTC
GAGGACGGCGGCTTCCTGGAGGCGACGATCGACCACGCGGGCGAGACGCCGATGGGCGCC
GGGCCCGATCTGCGCCGCATGCTGGTCCCGCTCGGGCCGGTCGCGGTCTTCGGGGCGAGC
AACTTCCCCCTGGCGTTCTCCGTACCGGGCGGGGACACGGTGTCGGCGCTGGCCGCCGGT
TGTCCCGTCGTCGTCAAGGCCCACGACTCCCACCCGGCCCTGTCGCGGCTGGTCTTCGAG
ACAATGGTCGCGGCCATCGCGGCGGCCGGCGGTCCGGACGGGCTGCTGGGGCTGGTGTTC
GGCCGGGAGGCGGGCACCGCCCTGGTCGCCCACCCGGCCATCAAGGCCGTGGGGTTCACC
GGCTCCCTCACGGGCGGCCGCGCGCTGCTCGATATCGCGGGCGCGCGCCCGGATCCGATT
CCGTTCTACGGTGAGCTGGCCGGTCTGAACCCGGTGGTCGTCACCGAGGGCGCGGCGCGG
GCCCGGCATTCCGAGATCGCGGCGGGGCTCGTCGCCTCGGTGACGGGTTCGGCCGGGCAA
CTGTGCACCAAGCCCGGTCTTGTCCTCGTTCCGGCCGGGGAAGCGGGCAACGCGCTGGTC
GCGGAGGCCGCCCGGCTCATCGACCAGGCGTCGGCCGCCACTTTGCTGGGCTCCCGCATC
GCCACCGCGTACGAGGCCGGCACGGAGGAGTTGCGCCACCGTGCCGGCGGGATGGCGGCC
GCCGAGGGCGGCGCCCCGTCCGGGTCCGGGTTCTCGGTGACGCCGCGGCTGTTCGAGATC
GACTCCGAAACGCTTCAGGACGAGCCCGTCGGAGAGTGCTTCGGCCCGGCCGCCGTCGTG
GTCCGCTATGCGCCAGGCCGCGCGGAGGCCGTTCTGCGGTCGCTGCCCGCTTCGCTGACG
GGAACCATTCACGCCGAAGCCGATGAGACGGAGACGGTGCGCCGTCTCACCGACGTGCTG
CGGCCGCTGGCCGGCCGTCTGCTCTACAACGGCTTCCCCACCGGCGTCCTGGTCTCCTGG
GCACAGCACCACGGCGGTCCCTGGCCGTCGACGAACAGCCTGCACACCTCCGTGGGTCCG
TACGCGGTGCGGCGCTTTCTGCGCCCTGTCACCTGGCAGAACGCGCCCCAGGAGGTGCTT
CCCGAAGAGCTGCGGGACGGCTTCGCCGGGATTCCCCGGCGCATCGAAGGGCGGCTCACC
GCGCCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR015590 Aldehyde dehydrogenase domain (Domain)
 [4-445]  1.6e-42 PF00171
PF00171   Aldedh
IPR016161 Aldehyde/histidinol dehydrogenase (Domain)
 [2-501]  1.19999063421924e-79 SSF53720
SSF53720   Aldehyde_DH/Histidinol_DH
IPR016162 Aldehyde dehydrogenase, N-terminal (Domain)
 [3-253]  1.2e-41 G3DSA:3.40.605.10
G3DSA:3.40.605.10   Aldehyde_dehydrogenase_N
IPR016163 Aldehyde dehydrogenase, C-terminal (Domain)
 [254-434]  2.99999999999998e-39 G3DSA:3.40.309.10
G3DSA:3.40.309.10   Aldehyde_dehydrogenase_C
SignalP
 [1-29]  0.034 Signal
Bacteria, Gram-negative   
TMHMM No significant hit