close all open/close all

CDS information : Meili_00470


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction115,772 / 114,915 / - [in whole cluster]
115,772 / 114,915 / - [in contig]
Locationcomplement(114915..115772) [in whole cluster]
complement(114915..115772) [in contig]
TypeCDS
Length858 bp (285 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)aldose 1-epimerase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf38

close this sectionSequence

selected fasta
>[aldose 1-epimerase]
MTAEIDEQGAELCSLRYGTEGQPGATELLWQAERAWPWHAPLLFPVIGRMNGDRLRHDGT
YYAMPKHGFARDRRFTVERHDATTAVLTLRDDAATRRLFPFPFRLTVGYAVEGSRLTVSY
SVHNPGPGTLPASLGVHPGFRWPLPGATDKRGHTVLFERPEPAPVRRVEDVLLLPERHPT
PVRGRTLRLDGALFTDGAVILEALNSSRLIYSAPGSPRVTLSWHGFRQLALWSPPEADLL
CLEPWYGLPSPIGSDGEYAASPGQFHLAAGRSRTFGFGVEVSPAR
selected fasta
>[aldose 1-epimerase]
GTGACGGCCGAGATCGACGAGCAGGGCGCCGAGTTGTGCTCGCTGCGATACGGCACGGAG
GGGCAGCCGGGGGCAACGGAACTGCTCTGGCAGGCGGAACGGGCCTGGCCCTGGCATGCG
CCGCTGCTCTTCCCCGTCATCGGCCGGATGAACGGCGACCGGCTGCGGCACGACGGCACG
TACTACGCCATGCCCAAGCACGGATTCGCCCGCGACCGGCGGTTCACGGTCGAGCGCCAC
GACGCCACCACCGCCGTCCTCACGCTGAGGGACGACGCGGCAACTCGTCGGCTCTTCCCG
TTCCCCTTCCGCCTCACGGTCGGCTACGCGGTCGAGGGCAGCCGTCTCACGGTGTCGTAC
TCCGTGCACAACCCGGGCCCAGGGACGCTGCCGGCGTCCCTGGGCGTCCATCCGGGCTTT
CGCTGGCCACTGCCCGGCGCGACTGACAAGCGCGGCCATACGGTGCTCTTCGAACGGCCG
GAACCCGCGCCCGTACGACGGGTCGAGGACGTGCTGCTGCTCCCCGAGCGGCACCCCACG
CCGGTCCGTGGCCGGACACTCCGCCTGGACGGGGCCCTGTTCACCGATGGCGCCGTGATC
CTCGAAGCGCTCAACAGCTCGCGCCTCATCTACAGCGCCCCTGGCTCGCCCAGGGTGACG
CTGAGCTGGCATGGATTCCGGCAGCTGGCCCTGTGGTCGCCGCCCGAGGCCGATCTGCTG
TGCCTCGAGCCGTGGTACGGCCTGCCCTCCCCGATCGGATCCGACGGCGAGTACGCGGCA
AGCCCCGGCCAGTTCCACCTCGCCGCGGGCCGGTCACGGACGTTCGGCTTCGGCGTCGAG
GTCAGTCCGGCGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008183 Aldose 1-/Glucose-6-phosphate 1-epimerase (Family)
 [1-247]  2.7e-23 PF01263
PF01263   Aldose_epim
IPR011013 Glycoside hydrolase-type carbohydrate-binding (Domain)
 [1-285]  4.30000170645869e-43 SSF74650
SSF74650   Gal_mut_like
IPR014718 Glycoside hydrolase-type carbohydrate-binding, subgroup (Domain)
 [2-141]  1.1e-14 G3DSA:2.70.98.10
G3DSA:2.70.98.10   Glyco_hydro_42_D5
SignalP
 [1-52]  0.056 Signal
Eukaryota   
TMHMM No significant hit