close all open/close all

CDS information : Meili_00480


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction115,938 / 117,386 / + [in whole cluster]
115,938 / 117,386 / + [in contig]
Location115938..117386 [in whole cluster]
115938..117386 [in contig]
TypeCDS
Length1,449 bp (482 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sugar transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf39

close this sectionSequence

selected fasta
>[sugar transporter]
MTNSVSAAARAADQPTKEAGTPHPRSPRPAVIYFFGALGGILFGYETGVIAGALTFIQKT
PGFPASAVTTGLIVGGIAGGAVFGALVAGRLADRFGRRPVIFVIGLIYIVGSVACAVAQN
NTWLIAARIFLGLAVGGSSSLVPVYLSEMAPARTRGRLAGLNQLMIVTGLLLGYLTNLAL
SGSGDWRTMLATGAAPAVVLIAGLKLLPESPRWLILHGREEEARALLAGTRSAEEADRDI
AAIREVTTHTPHRRELLAGWIRPAMIIGIGIPILTQYTGLNIVTYYAPTIFESLGLPHEN
ALYFTIILGTVKVLSVMVGLQLIDRLGRRFLFLAGSAAMAVSMSWMAYEASRGDAMSPGA
MLTAMSIMFVSYSLTWGPVNWVVLGEIFPLRVRGAAMGVAGMVTWLATLGITFGFPVMRD
AWGLTNTMIFFVGGNILGLLFCKVFVHETRGRTLEEIEEDLRERYDRKQQGKSAQSENGS
TS
selected fasta
>[sugar transporter]
ATGACGAACTCAGTCAGCGCCGCTGCCAGAGCCGCAGACCAGCCGACGAAGGAAGCGGGA
ACGCCGCACCCGCGCTCCCCGCGCCCGGCGGTGATCTACTTCTTCGGCGCCCTCGGCGGC
ATTCTGTTCGGCTACGAAACAGGCGTCATCGCGGGCGCCCTGACCTTCATCCAGAAGACA
CCGGGCTTCCCCGCCAGTGCGGTCACCACGGGGCTGATCGTCGGTGGCATCGCGGGCGGC
GCCGTGTTCGGCGCCCTTGTCGCCGGGCGGCTCGCCGACCGGTTCGGCCGCCGACCCGTG
ATCTTCGTGATCGGCCTGATCTATATCGTCGGCTCCGTCGCCTGCGCGGTGGCCCAGAAC
AACACCTGGCTCATCGCCGCCCGGATCTTCCTGGGGCTCGCGGTGGGCGGCTCTTCCTCC
CTGGTGCCGGTCTATCTGTCGGAGATGGCGCCGGCCCGCACCCGGGGCCGGCTCGCCGGA
CTGAACCAGCTGATGATCGTGACCGGGCTGCTGCTCGGCTATCTCACCAACCTCGCCCTG
TCCGGCAGCGGTGACTGGCGGACGATGCTGGCCACGGGAGCCGCCCCGGCCGTCGTCCTG
ATCGCGGGGCTGAAGCTGCTGCCGGAGAGCCCCCGCTGGCTGATCCTCCACGGCCGCGAA
GAGGAAGCCCGAGCGCTGCTCGCCGGCACCCGCTCGGCCGAGGAGGCCGACCGCGACATC
GCGGCCATCCGCGAGGTGACCACGCACACCCCGCACCGCCGCGAGCTGCTGGCCGGCTGG
ATCCGGCCCGCGATGATCATCGGCATCGGCATTCCGATCCTGACCCAGTACACCGGGCTC
AACATCGTCACCTACTACGCTCCCACGATCTTCGAGAGCCTGGGTCTTCCGCATGAGAAC
GCCCTCTACTTCACGATCATCCTGGGCACCGTGAAGGTCCTCTCCGTCATGGTCGGTCTT
CAGCTGATCGACCGGCTCGGCCGCCGGTTCCTGTTCCTCGCCGGAAGCGCGGCGATGGCC
GTGAGCATGAGCTGGATGGCGTACGAGGCCTCGCGTGGCGACGCCATGAGTCCGGGCGCC
ATGCTCACCGCGATGAGCATCATGTTCGTCAGCTACTCCCTGACGTGGGGGCCCGTGAAC
TGGGTCGTCCTCGGCGAGATCTTCCCGCTGCGGGTCCGGGGCGCGGCGATGGGCGTCGCC
GGCATGGTCACCTGGCTGGCCACCCTCGGCATCACCTTCGGCTTCCCCGTCATGCGTGAC
GCCTGGGGCCTGACCAACACCATGATCTTCTTCGTCGGCGGCAACATCCTCGGCCTCCTC
TTCTGCAAGGTCTTCGTGCACGAGACCCGGGGCCGCACCCTGGAGGAGATCGAGGAAGAC
TTGCGGGAGCGGTACGACCGCAAGCAGCAGGGCAAGAGCGCTCAGAGCGAGAACGGAAGC
ACCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003663 Sugar/inositol transporter (Family)
 [40-50]  7.79998304125571e-24 PR00171 [125-144]  7.79998304125571e-24 PR00171 [275-285]  7.79998304125571e-24 PR00171 [362-383]  7.79998304125571e-24 PR00171 [385-397]  7.79998304125571e-24 PR00171
PR00171   SUGRTRNSPORT
 [29-457]  9.80000000000012e-106 TIGR00879
TIGR00879   SP
IPR005828 General substrate transporter (Family)
 [34-460]  9.80000000000012e-113 PF00083
PF00083   Sugar_tr
IPR005829 Sugar transporter, conserved site (Conserved_site)
 [88-105]  PS00216 [319-336]  PS00216
PS00216   SUGAR_TRANSPORT_1
 [130-155]  PS00217
PS00217   SUGAR_TRANSPORT_2
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-463]  8.79996401030984e-85 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [32-450]  PS50850
PS50850   MFS
SignalP
 [1-11]  0.69 Signal
Bacteria, Gram-negative   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [33-55]  Transmembrane (i-o) [65-87]  Transmembrane (o-i) [100-119]  Transmembrane (i-o) [124-146]  Transmembrane (o-i) [158-180]  Transmembrane (i-o) [190-207]  Transmembrane (o-i) [264-286]  Transmembrane (i-o) [301-323]  Transmembrane (o-i) [330-347]  Transmembrane (i-o) [362-384]  Transmembrane (o-i) [396-418]  Transmembrane (i-o) [428-447]  Transmembrane (o-i)
Transmembrane 12