close all open/close all

CDS information : Meili_00490


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction117,383 / 118,279 / + [in whole cluster]
117,383 / 118,279 / + [in contig]
Location117383..118279 [in whole cluster]
117383..118279 [in contig]
TypeCDS
Length897 bp (298 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)2-hydroxycyclohexanecarboxyl-CoA dehyrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf40

close this sectionSequence

selected fasta
>[2-hydroxycyclohexanecarboxyl-CoA dehyrogenase]
MNHPLDPEAEHSDGPPRGYGLLRGRTALVTGGARNIGRGIALRFAAEGARVVVADTAADA
ADATVEHIRASGGNALAVVTDLCTEAGAEQAFAAAESHFGLVDTLVNNAYARVDARAFGP
FLRLTGAVWDEFHRVNLGLLFHPTHRMARALADAEKPGTVVNISSHAAARAHRNHIPYDT
VKGGVDAFTRAVAVDLAPWNIRVNAVRPGSVEVDTSDPDPQARHFRAAQIPLHREGTPDD
IATSAVYLASELSQWVTGQVFNVDGGMAAQARPPQTENGPVWTPRNIDDYDATLERRA
selected fasta
>[2-hydroxycyclohexanecarboxyl-CoA dehyrogenase]
ATGAACCACCCCCTCGATCCCGAGGCCGAGCACAGCGACGGCCCGCCCCGCGGGTACGGT
CTGCTGCGCGGGCGGACGGCACTGGTCACCGGGGGCGCCCGCAACATCGGTCGGGGTATC
GCCCTGCGCTTCGCCGCCGAGGGCGCACGGGTCGTGGTCGCGGACACCGCGGCCGACGCG
GCGGACGCCACGGTGGAACACATCCGCGCGAGTGGCGGAAACGCCCTCGCCGTCGTCACC
GACCTGTGCACGGAAGCCGGCGCCGAGCAGGCGTTCGCCGCCGCCGAAAGCCACTTCGGC
CTCGTCGACACCCTCGTGAACAACGCCTACGCACGCGTGGACGCGCGCGCCTTCGGCCCC
TTCCTGCGGCTCACCGGGGCAGTGTGGGACGAGTTCCACCGGGTCAATCTGGGGCTGCTG
TTCCACCCCACCCACCGCATGGCCAGGGCACTCGCCGACGCGGAAAAGCCCGGCACGGTG
GTCAACATCAGCTCCCACGCCGCCGCCCGCGCCCACCGCAACCACATCCCCTACGACACG
GTCAAGGGCGGTGTGGACGCCTTCACCCGGGCCGTCGCCGTCGATCTCGCCCCCTGGAAC
ATCCGGGTCAACGCGGTGCGCCCCGGCTCCGTCGAGGTCGACACCAGCGACCCCGACCCG
CAGGCCCGCCACTTCCGGGCCGCGCAGATCCCCTTGCACCGCGAGGGAACCCCCGACGAC
ATCGCCACCAGCGCGGTCTACCTCGCCTCCGAGCTGTCGCAGTGGGTCACCGGACAGGTC
TTCAACGTCGACGGCGGCATGGCGGCGCAGGCCCGTCCGCCGCAGACCGAGAACGGCCCG
GTGTGGACACCGCGGAACATCGACGACTACGACGCCACCTTGGAAAGGCGGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [100-111]  1e-07 PR00080 [158-166]  1e-07 PR00080 [178-197]  1e-07 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [26-43]  1.40000506907309e-33 PR00081 [100-111]  1.40000506907309e-33 PR00081 [152-168]  1.40000506907309e-33 PR00081 [178-197]  1.40000506907309e-33 PR00081 [199-216]  1.40000506907309e-33 PR00081 [231-251]  1.40000506907309e-33 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [22-269]  1.29999999999998e-70 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit