close all open/close all

CDS information : Meili_00500


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction118,276 / 119,445 / + [in whole cluster]
118,276 / 119,445 / + [in contig]
Location118276..119445 [in whole cluster]
118276..119445 [in contig]
TypeCDS
Length1,170 bp (389 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)isomerase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf41

close this sectionSequence

selected fasta
>[isomerase]
MSTRTVVTEVETFPLEAHLPDGGYGASKVRLPVRVATLVKVTTSDGAVGWGESFGPPRLI
APFLADQAQALVGQPADIREDRILDRLSLGYHLTAGGPHVAAASGIDIALWDAQARSFGV
PVAHLLGGRLHDRVDAYASSGYVTATREPGEFRDTMASHAAEGFTAVKIKIGLTPDEDRQ
RTAAARAAMGDDGLVIVDYNANCTVATARRSLARIRDLDPYWVEEPLPPEDSAGWRELRD
VHLPLSGGEALYTRYGFRDPIAEHRFDIVQPDLAKCGGFTEAQAIRQLAAAFNLRLSPHC
WGTGVAQAATLQLLSATPRAPFGMAGGEPLIFEFDRGENPLREGVLAAPLTPVNGTVAVP
DGPGIGVTVDEEWVRAHRLEDHSILVRAR
selected fasta
>[isomerase]
ATGAGCACACGAACCGTCGTCACCGAAGTCGAGACGTTTCCCCTCGAGGCCCATCTGCCG
GACGGCGGCTACGGCGCCTCGAAGGTCCGACTGCCGGTACGCGTCGCCACCCTGGTGAAG
GTCACCACCTCGGACGGCGCCGTCGGCTGGGGCGAGTCCTTCGGCCCGCCGCGGCTGATC
GCCCCGTTCCTCGCCGACCAGGCCCAGGCGCTGGTGGGGCAGCCCGCCGACATCCGGGAG
GACCGCATCCTGGACCGGCTCTCCCTCGGCTACCACCTCACCGCCGGTGGCCCTCATGTG
GCGGCGGCCAGCGGTATCGACATCGCGCTCTGGGACGCGCAGGCCCGCTCGTTCGGCGTA
CCGGTGGCTCACCTGCTGGGCGGCCGGCTCCACGACCGGGTCGACGCCTACGCCTCCTCC
GGCTATGTCACCGCCACCCGCGAACCCGGCGAATTCCGGGACACGATGGCCTCCCACGCC
GCCGAGGGCTTCACCGCCGTCAAGATCAAGATCGGGCTGACGCCGGATGAGGACCGGCAG
CGTACGGCCGCCGCCCGCGCGGCCATGGGCGACGACGGTCTGGTGATCGTCGACTACAAC
GCCAACTGCACCGTCGCGACCGCCCGCCGCTCCCTGGCCCGGATACGGGACCTCGACCCG
TACTGGGTGGAGGAGCCGCTGCCGCCCGAAGACAGCGCCGGATGGCGCGAGTTGCGCGAT
GTACACCTGCCGCTCTCCGGTGGCGAAGCCCTCTACACCCGCTACGGCTTCCGCGACCCC
ATCGCCGAGCACCGCTTCGACATCGTCCAGCCCGACCTGGCCAAATGCGGCGGCTTCACC
GAGGCCCAGGCCATCCGCCAGCTCGCCGCGGCCTTCAACCTGCGGCTGTCCCCGCACTGC
TGGGGCACCGGGGTCGCCCAGGCCGCGACGCTCCAGTTGCTGTCGGCGACACCCCGGGCG
CCCTTCGGCATGGCCGGCGGGGAGCCGCTGATCTTCGAATTCGACCGGGGCGAGAACCCG
CTGCGTGAGGGCGTCCTCGCGGCTCCTCTCACACCGGTGAACGGCACTGTGGCCGTACCC
GACGGCCCCGGCATCGGGGTCACCGTCGACGAGGAATGGGTACGCGCCCACCGTCTGGAG
GATCACAGCATCCTGGTCCGGGCGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013341 Mandelate racemase/muconate lactonizing enzyme, N-terminal (Domain)
 [37-127]  4.9e-13 PF02746
PF02746   MR_MLE_N
IPR013342 Mandelate racemase/muconate lactonizing enzyme, C-terminal (Domain)
 [149-244]  1.89999859865865e-21 SM00922
SM00922   MR_MLE
IPR018110 Mandelate racemase/muconate lactonizing enzyme, conserved site (Conserved_site)
 [195-226]  PS00909
PS00909   MR_MLE_2
 [102-127]  PS00908
PS00908   MR_MLE_1
SignalP
 [1-2]  0.118 Signal
Eukaryota   
TMHMM No significant hit