close all open/close all

CDS information : Meili_00510


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction120,278 / 119,490 / - [in whole cluster]
120,278 / 119,490 / - [in contig]
Locationcomplement(119490..120278) [in whole cluster]
complement(119490..120278) [in contig]
TypeCDS
Length789 bp (262 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf42

close this sectionSequence

selected fasta
>[transcriptional regulator]
MTSPATTSSVLGPGAGALDRGLAILDHMAVARTCSTQDLAAALGLSRSTAYRLVDRLVEG
GWLAVEQGSGLLRLGPSATRLASAAVGSTDLTATAMPIISRLMRETRETASLGVPNGVNM
VFVHRERGPRPVAVTSELGAGRPLHCTSLGRAYLAALPQQALEEKLAELVASSESPVDEG
SVGDLRKILQETRERGWSEDRREFDESSCCCGAAVYDHTGMPVAAISVAGVAERMERILS
DVGPLVAEAAAEISAGLGHVRR
selected fasta
>[transcriptional regulator]
ATGACCTCGCCCGCCACCACCTCCTCTGTTCTCGGGCCGGGCGCCGGCGCTCTGGACCGC
GGTCTGGCCATCCTCGACCACATGGCTGTGGCCCGCACATGCTCCACCCAGGACCTCGCC
GCGGCGCTGGGGCTCAGCCGCAGTACCGCCTACCGGCTGGTCGACCGCCTTGTCGAGGGC
GGCTGGCTCGCCGTGGAACAGGGGAGCGGGCTGTTGCGGCTCGGGCCTTCGGCCACGCGA
CTGGCCTCCGCGGCGGTGGGCTCGACGGATCTGACCGCCACGGCGATGCCGATCATCTCC
CGGCTGATGCGGGAGACCCGGGAGACGGCCAGCCTCGGGGTCCCGAACGGCGTGAACATG
GTGTTCGTGCATCGCGAGCGCGGTCCGCGCCCGGTGGCGGTGACGAGCGAACTGGGGGCG
GGGCGGCCACTGCACTGCACTTCGCTGGGGCGGGCCTATCTGGCGGCTCTTCCGCAGCAG
GCGCTGGAGGAGAAGCTGGCGGAGCTGGTGGCGTCGAGCGAGTCCCCGGTGGATGAGGGC
TCGGTCGGTGATCTGCGGAAGATCCTCCAGGAGACGCGGGAGCGCGGCTGGTCGGAGGAT
CGGCGGGAGTTCGACGAGTCCAGTTGCTGCTGCGGGGCCGCTGTTTACGACCACACCGGT
ATGCCCGTCGCGGCGATCAGCGTCGCCGGAGTGGCGGAGCGCATGGAACGGATCCTGAGT
GACGTAGGTCCGCTGGTGGCCGAGGCGGCCGCCGAGATCTCAGCGGGCCTCGGCCACGTA
CGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005471 Transcription regulator IclR, N-terminal (Domain)
 [17-64]  1.7e-12 PF09339
PF09339   HTH_IclR
 [15-104]  4.00000300869883e-19 SM00346
SM00346   HTH_ICLR
 [15-76]  PS51077
PS51077   HTH_ICLR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [14-85]  2.4e-15 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR014757 Transcription regulator IclR, C-terminal (Domain)
 [132-254]  7.20000000000003e-23 PF01614
PF01614   IclR
 [77-259]  PS51078
PS51078   ICLR_ED
SignalP
 [1-17]  0.561 Signal
Eukaryota   
TMHMM No significant hit