close all open/close all

CDS information : Meili_00520


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction121,447 / 120,722 / - [in whole cluster]
121,447 / 120,722 / - [in contig]
Locationcomplement(120722..121447) [in whole cluster]
complement(120722..121447) [in contig]
TypeCDS
Length726 bp (241 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)acetyl-xylan esterase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf43

close this sectionSequence

selected fasta
>[acetyl-xylan esterase]
MLGNARNRLRITLIAAATAAMAAFSMAASLAATPDEARADAAWANCPNGYVGLTYDDGPN
PASTQALLNALRAGGAKATFFIWGQHAEQYPDLLKAEQSAGMWIANHTATHAHLTQIGEP
AAYNEIATAQNTIKRITGQSPTLFRPPYGETNAQVKADAARLGLTEVLWSVDSQDWNGAS
TQQIVQAAATMRAGSIILMHDGGYQTTVSAVPQILSGLAARGLCPGRITAGAGGGAVVTA
P
selected fasta
>[acetyl-xylan esterase]
ATGCTCGGAAACGCGCGCAACCGCTTACGGATCACGCTCATCGCCGCGGCCACGGCCGCC
ATGGCGGCGTTCTCAATGGCGGCCTCCCTGGCGGCCACGCCTGATGAGGCACGCGCCGAC
GCGGCCTGGGCCAACTGCCCCAACGGATACGTGGGTCTGACGTACGACGACGGACCGAAC
CCCGCGTCGACACAGGCGCTGCTCAATGCTCTGCGGGCGGGCGGGGCCAAGGCCACCTTC
TTCATCTGGGGGCAGCACGCCGAGCAGTACCCGGACCTGCTCAAGGCCGAGCAGTCGGCG
GGTATGTGGATCGCCAACCACACCGCCACCCACGCCCACCTCACCCAGATCGGCGAACCG
GCCGCGTACAACGAGATCGCCACCGCCCAGAACACCATCAAGCGCATCACCGGACAGTCC
CCCACCCTCTTCCGGCCTCCTTACGGGGAGACCAATGCGCAGGTCAAGGCGGACGCGGCC
CGTCTGGGGCTGACCGAGGTCCTGTGGAGCGTGGATTCCCAGGACTGGAACGGCGCCAGC
ACCCAGCAGATCGTCCAGGCCGCCGCCACCATGCGGGCCGGCAGCATCATCCTCATGCAC
GACGGTGGTTACCAGACCACCGTGAGCGCCGTGCCGCAGATCCTCAGCGGGCTCGCCGCA
CGCGGGCTGTGCCCCGGCCGGATCACCGCCGGAGCCGGCGGGGGCGCGGTCGTGACCGCT
CCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002509 Polysaccharide deacetylase (Domain)
 [47-166]  5.90000000000001e-31 PF01522
PF01522   Polysacc_deac_1
 [21-227]  1.70000000000001e-54 G3DSA:3.20.20.370
G3DSA:3.20.20.370   Polysac_deacetylase
IPR011330 Glycoside hydrolase/deacetylase, beta/alpha-barrel (Domain)
 [36-233]  2.19999900980707e-54 SSF88713
SSF88713   Glyco_hydro/deAcase_b/a-brl
SignalP
 [1-31]  1 Signal
Bacteria, Gram-negative   
 [1-31]  0.995 Signal
Eukaryota   
 [1-31]  1 Signal
Bacteria, Gram-positive   
TMHMM
 [13-32]  Transmembrane (i-o)
Transmembrane 1