close all open/close all

CDS information : Meili_00530


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction122,463 / 121,600 / - [in whole cluster]
122,463 / 121,600 / - [in contig]
Locationcomplement(121600..122463) [in whole cluster]
complement(121600..122463) [in contig]
TypeCDS
Length864 bp (287 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)citrate lyase beta subunit
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf44

close this sectionSequence

selected fasta
>[citrate lyase beta subunit]
MDHLTTARTWLFVPGHRPDRFDKAASSGADLVIIDLEDAVPAADKDRSRGHAAAWLARGG
RAVVRINPPGTPWFEADLHTAADHGCPVLVPKAEDPAVLAGIFARTAECCPLVALIETAL
GVERAREVCATPGVVRAAFGNVDLAAQLGVAHDDHLALAHARSRLVLASAAAGVRPPVDG
VTTAVRDAEALAADVAHARRLGLTGKLCVHPAQLGAVVDGLTPSESEVRWARAVLDTGEA
VTTVDGQMVDKPVLARARRVLAQRATGNFSGPSTPRSSLRPGPSESC
selected fasta
>[citrate lyase beta subunit]
ATGGACCACCTCACCACGGCGCGCACATGGCTCTTCGTGCCCGGACACCGGCCCGACCGC
TTCGACAAGGCGGCCTCCTCCGGCGCCGACCTGGTCATCATCGACCTGGAGGACGCGGTC
CCCGCCGCGGACAAGGACCGCTCCCGTGGCCATGCCGCCGCCTGGCTCGCCCGCGGCGGC
CGGGCGGTCGTACGGATCAACCCGCCCGGAACCCCCTGGTTCGAGGCCGATCTGCACACG
GCCGCCGACCACGGCTGCCCGGTGCTGGTGCCCAAGGCGGAGGATCCGGCCGTGCTCGCG
GGCATCTTTGCCCGCACGGCCGAGTGCTGTCCGCTCGTCGCGCTCATCGAGACGGCCCTC
GGAGTGGAACGGGCCCGTGAGGTGTGCGCCACCCCGGGCGTCGTCCGGGCCGCCTTCGGC
AATGTCGACCTCGCCGCCCAGCTCGGCGTCGCCCACGACGACCATCTCGCGCTGGCCCAT
GCGCGCTCGCGTCTCGTGCTCGCCTCGGCCGCGGCCGGCGTCCGGCCACCGGTCGACGGT
GTCACCACCGCCGTGCGGGACGCGGAAGCGCTCGCCGCCGACGTCGCCCACGCCCGACGC
CTGGGCTTGACCGGAAAGCTCTGTGTCCACCCCGCACAGCTCGGGGCGGTCGTCGACGGA
CTCACCCCGTCCGAGAGCGAGGTGCGGTGGGCGCGCGCCGTCCTGGACACGGGTGAGGCG
GTCACCACGGTCGACGGGCAGATGGTCGACAAGCCGGTCCTGGCCCGCGCGCGGCGGGTA
CTGGCGCAGCGGGCTACCGGAAACTTTTCGGGCCCGTCCACCCCAAGATCCTCACTGCGG
CCGGGCCCCTCTGAATCGTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005000 Aldehyde-lyase domain (Domain)
 [8-211]  3.7e-34 PF03328
PF03328   HpcH_HpaI
IPR011206 Citrate lyase, beta subunit (Family)
 [1-270]  2.7000136937899e-77 PIRSF015582
PIRSF015582   Cit_lyase_B
IPR015813 Pyruvate/Phosphoenolpyruvate kinase (Domain)
 [5-223]  1.79999999999997e-69 G3DSA:3.20.20.60
G3DSA:3.20.20.60   Pyrv/PenolPyrv_Kinase_cat
 [1-223]  1.20000117458134e-61 SSF51621
SSF51621   Pyrv/PenolPyrv_Kinase_cat
SignalP No significant hit
TMHMM No significant hit