close all open/close all

CDS information : Meili_00540


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction123,400 / 122,516 / - [in whole cluster]
123,400 / 122,516 / - [in contig]
Locationcomplement(122516..123400) [in whole cluster]
complement(122516..123400) [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf45

close this sectionSequence

selected fasta
>[hypothetical protein]
MPATPLPIGSYVTSWRPGPVTEEDRLNPGPVSAVSALLDLPHTVAGTGDALPPLWQWFYF
LHWPAQHELGADGHLRDARFLPPIPDRQRMFAGGRCEVSEPLRLGEPTERVSSLSAVTPK
QGRTGELLFITERQEFRQSGRLCVVEEQDIVYRSGRGPAGAHPTALDDQATATAEGPWRL
SLQPDPTLLFRFSALTANAHRIHYDAPYCRDTEGYPGLVVHGPLLALLMLELVRRNAPER
RVRTLSYRLRRPVFAGERILADGAAADGRAGLRIATHREARHATAEVTFACRQD
selected fasta
>[hypothetical protein]
ATGCCAGCCACCCCGCTCCCGATCGGCTCCTACGTCACATCGTGGCGCCCCGGCCCGGTC
ACCGAGGAGGACCGTCTGAACCCGGGTCCGGTCAGCGCCGTGTCCGCGCTCCTCGATCTG
CCTCATACGGTCGCCGGAACCGGAGATGCGCTGCCACCCCTGTGGCAGTGGTTCTACTTC
CTGCACTGGCCCGCCCAGCACGAGCTGGGCGCCGATGGCCATCTGCGTGACGCCCGCTTC
CTGCCGCCCATCCCCGACCGGCAGCGCATGTTCGCCGGGGGACGCTGCGAGGTCAGCGAA
CCGCTGCGCCTCGGCGAGCCCACCGAACGCGTCAGCAGCCTGAGCGCGGTGACACCCAAG
CAGGGTCGCACAGGCGAGCTGCTGTTCATCACCGAGCGCCAGGAGTTCCGGCAGTCCGGT
CGCCTGTGCGTGGTCGAGGAACAGGACATCGTCTACCGCTCGGGCCGCGGCCCCGCCGGA
GCGCACCCGACCGCACTCGACGACCAGGCCACCGCCACGGCCGAGGGCCCGTGGCGGCTG
AGTCTGCAACCCGACCCCACGCTGCTGTTCCGGTTCAGCGCCCTGACCGCCAACGCGCAC
CGCATCCACTACGACGCCCCGTACTGCCGCGACACGGAGGGCTATCCGGGCCTTGTCGTC
CACGGCCCGCTGCTGGCCCTGCTCATGCTCGAACTGGTCCGCCGCAACGCCCCCGAGCGC
CGCGTACGCACGCTGTCCTACCGGCTGCGGCGACCGGTCTTCGCCGGTGAGCGCATCCTG
GCCGACGGAGCTGCCGCCGACGGGCGGGCCGGGCTTCGTATCGCCACCCATCGGGAGGCA
CGGCACGCCACCGCCGAGGTGACGTTCGCATGCCGCCAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002539 MaoC-like dehydratase (Domain)
 [187-272]  0.00022 PF01575
PF01575   MaoC_dehydratas
SignalP
 [1-50]  0.158 Signal
Bacteria, Gram-positive   
 [1-33]  0.157 Signal
Bacteria, Gram-negative   
TMHMM No significant hit