close all open/close all

CDS information : Meili_00550


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction124,077 / 123,478 / - [in whole cluster]
124,077 / 123,478 / - [in contig]
Locationcomplement(123478..124077) [in whole cluster]
complement(123478..124077) [in contig]
TypeCDS
Length600 bp (199 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sulfopyruvate decarboxylase beta subunit
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf46

close this sectionSequence

selected fasta
>[sulfopyruvate decarboxylase beta subunit]
MTAADTTPRLDRRRFVADLMARIPEDTLVVTGLGSPGYDVFAAGDRPGTFYLWGAMGAAA
PLALGLALARPERPVLAVTGDGEHLMGIGALATIGAKLPPNLTLVVLDNAHFGETGMQPS
HTGLGTDLVAVAQGFGIRDAVRIADPARTEDLAARIRARAATAYAQVLIDTDEPPRALPP
RDAVANKNSFRATLGLTTF
selected fasta
>[sulfopyruvate decarboxylase beta subunit]
ATGACCGCCGCCGACACCACTCCACGCCTGGACCGGCGCCGCTTCGTCGCCGATCTGATG
GCCCGCATCCCCGAGGACACCCTGGTGGTCACCGGCCTCGGATCGCCCGGCTACGACGTG
TTCGCGGCCGGCGACCGCCCCGGCACCTTCTATCTGTGGGGCGCGATGGGCGCCGCCGCC
CCGCTCGCCCTCGGCCTCGCTCTGGCCCGGCCCGAGCGCCCCGTGCTCGCGGTCACCGGC
GACGGAGAACACCTCATGGGCATCGGCGCGCTGGCCACCATCGGCGCCAAGCTGCCGCCC
AACCTCACCCTCGTCGTCCTGGACAACGCCCACTTCGGCGAGACCGGTATGCAGCCCAGC
CACACCGGCCTGGGCACCGACCTCGTCGCCGTGGCCCAGGGCTTCGGCATCCGCGACGCC
GTACGGATCGCCGACCCCGCCCGCACCGAGGACCTGGCCGCCCGCATCCGGGCGCGCGCC
GCCACCGCCTACGCCCAGGTGCTCATCGACACGGACGAGCCGCCGCGCGCCCTCCCACCG
CGCGACGCCGTGGCCAACAAGAACTCCTTCCGCGCCACGCTGGGCCTGACCACCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011766 Thiamine pyrophosphate enzyme, C-terminal TPP-binding (Domain)
 [48-157]  8.89999999999994e-19 PF02775
PF02775   TPP_enzyme_C
SignalP No significant hit
TMHMM No significant hit