close all open/close all

CDS information : Meili_00560


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction124,613 / 124,077 / - [in whole cluster]
124,613 / 124,077 / - [in contig]
Locationcomplement(124077..124613) [in whole cluster]
complement(124077..124613) [in contig]
TypeCDS
Length537 bp (178 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sulfopyruvate decarboxylase alpha subunit
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf47

close this sectionSequence

selected fasta
>[sulfopyruvate decarboxylase alpha subunit]
MTQTHAPAPAWQQAVFTALKKRGVQQIAYVPDSGHSHVIREAQRDPAIHDVVLTTEEEGV
AVVSGAWLGGQRAVLLMQSSGVGNCVNMFSLPQMARFPFLTLVTMRGEYAEFNPWQGPMG
RTTQQALELMGITVVRADTPEEVEDTVEAALDSAFEAGERVAVLLGQKLIGRKKWERH
selected fasta
>[sulfopyruvate decarboxylase alpha subunit]
ATGACCCAGACCCATGCACCAGCGCCTGCGTGGCAGCAGGCCGTGTTCACCGCCCTGAAG
AAGCGCGGAGTCCAGCAGATCGCCTACGTCCCCGACTCCGGCCACTCCCATGTCATCAGG
GAGGCCCAGCGGGACCCCGCCATCCACGACGTGGTGCTGACCACCGAGGAGGAGGGTGTC
GCCGTGGTCAGCGGGGCGTGGCTGGGCGGGCAGCGGGCGGTGCTGCTGATGCAGAGCAGC
GGCGTGGGCAACTGCGTCAACATGTTCTCGCTGCCGCAGATGGCCCGGTTCCCCTTTCTG
ACGCTGGTGACGATGCGCGGCGAGTACGCCGAGTTCAACCCGTGGCAGGGCCCCATGGGC
CGCACCACCCAGCAGGCCCTGGAGCTCATGGGCATCACCGTCGTACGGGCCGACACCCCG
GAGGAGGTCGAGGACACGGTCGAGGCGGCGCTGGACTCGGCGTTCGAGGCGGGTGAGCGC
GTCGCCGTGCTGCTCGGACAGAAGCTGATCGGCCGCAAGAAGTGGGAGCGCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012001 Thiamine pyrophosphate enzyme, N-terminal TPP-binding domain (Domain)
 [12-164]  2.6e-10 PF02776
PF02776   TPP_enzyme_N
SignalP No significant hit
TMHMM No significant hit