close all open/close all

CDS information : Meili_00570


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction125,549 / 124,725 / - [in whole cluster]
125,549 / 124,725 / - [in contig]
Locationcomplement(124725..125549) [in whole cluster]
complement(124725..125549) [in contig]
TypeCDS
Length825 bp (274 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf48

close this sectionSequence

selected fasta
>[hydrolase]
MAPTDSHQPNGYARALDGTLLAYQRQGAGRPLVLLAGQANNHHWWDGIRADFHATHTTLT
MDWRGTGESGKPDEPYSTQGFADDVIAVLDHLGIDRADLYGTSMGGRVAQWVAARHPDRI
RRLVLGCTSPGGPQAKERDMGVRRSLAQADARAAREALIDLMYTPAWRSGHPGPYTTLGD
PAMPPHARRRHLVASNEHDTWDVLPLISAPTLILHGAEDRLTPAANVPLLAARIPKARTH
IFEGARHGYFEECRSAAGAIVASFLAEREGPDDV
selected fasta
>[hydrolase]
ATGGCACCCACCGACAGCCACCAGCCGAACGGCTACGCCCGCGCACTGGACGGCACCCTC
CTCGCCTATCAACGCCAGGGCGCAGGAAGGCCGCTGGTGCTCCTGGCGGGCCAGGCGAAC
AACCACCACTGGTGGGACGGCATACGGGCGGATTTCCACGCCACGCACACCACCCTCACC
ATGGACTGGCGTGGCACGGGGGAGAGCGGCAAACCCGATGAGCCCTACTCGACGCAGGGC
TTCGCCGACGATGTGATCGCCGTCCTCGACCATCTGGGCATCGACCGCGCCGACCTGTAC
GGGACCTCCATGGGCGGGCGGGTCGCCCAGTGGGTCGCCGCCCGCCACCCGGACCGGATC
CGGCGGCTCGTCCTCGGCTGCACCTCGCCCGGCGGGCCCCAGGCGAAGGAACGCGACATG
GGGGTGCGGCGCTCCCTGGCCCAGGCCGACGCGCGGGCGGCGAGGGAAGCCCTGATCGAC
CTCATGTACACCCCGGCCTGGCGCTCCGGACACCCCGGGCCCTATACGACCCTCGGCGAC
CCCGCCATGCCGCCGCACGCCCGGCGGCGCCACCTGGTGGCCAGCAACGAACACGACACC
TGGGACGTGCTCCCGCTGATCAGCGCGCCCACCCTGATCCTGCACGGAGCGGAGGACCGG
CTCACCCCCGCCGCGAACGTACCGCTGCTCGCCGCCCGCATCCCCAAGGCGCGTACCCAC
ATCTTCGAGGGCGCCCGGCACGGATATTTCGAAGAGTGCCGCTCGGCGGCCGGGGCGATC
GTGGCGTCGTTCCTGGCGGAGCGGGAAGGCCCGGACGACGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [55-70]  9.20000434662057e-12 PR00111 [99-112]  9.20000434662057e-12 PR00111 [113-126]  9.20000434662057e-12 PR00111 [211-225]  9.20000434662057e-12 PR00111
PR00111   ABHYDROLASE
SignalP No significant hit
TMHMM No significant hit