close all open/close all

CDS information : Meili_00580


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction126,582 / 125,629 / - [in whole cluster]
126,582 / 125,629 / - [in contig]
Locationcomplement(125629..126582) [in whole cluster]
complement(125629..126582) [in contig]
TypeCDS
Length954 bp (317 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)LysR-family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf49

close this sectionSequence

selected fasta
>[LysR-family transcriptional regulator]
MDVKQLKALVTVAEVGSVTRAAELLHLVQPAVTRQIRTLEQELGVALFERTRQGMRPTGA
GAIMVDRARRALNELERARVEVQPTPGVVTGIVTVGLLESTTELLAEPLVSALARDHPGI
ELRLMTAYSGHLQQWLDDGDLDLTLLYNLAGTPSLNVRPLVREHLWVVAPPSEGLRGDHP
VPFARVAEHPLVMPAAGHALRSLIDGAAGRAAVEMDIVVQTNSMRLQKQLVRAGHGWTVL
PGVGIAEDVAEGTLSAAPLCDPDVWRSIVLATPRNGRTPPAAEVVARELVRHIASAVHQG
RWPSAQLHAQIDRTDDT
selected fasta
>[LysR-family transcriptional regulator]
GTGGACGTCAAACAACTCAAGGCACTCGTCACGGTCGCCGAGGTCGGCAGCGTCACCCGG
GCCGCGGAGCTGCTGCATCTGGTGCAGCCCGCGGTCACCCGGCAGATCCGCACCCTGGAG
CAGGAGCTGGGCGTCGCCCTCTTCGAGCGGACCCGGCAGGGCATGCGGCCGACCGGGGCC
GGCGCCATCATGGTCGACCGTGCCCGCCGTGCGCTGAACGAGCTGGAGCGCGCCCGTGTC
GAGGTCCAGCCGACCCCGGGCGTGGTGACCGGCATCGTCACCGTGGGCCTGCTGGAGAGC
ACCACCGAGCTGCTGGCGGAGCCGTTGGTGTCCGCGCTCGCCCGCGACCATCCCGGGATC
GAGCTGCGCCTGATGACGGCGTACTCCGGACACCTCCAGCAGTGGCTGGACGACGGCGAC
CTGGACCTGACGCTGCTCTACAACCTGGCCGGCACCCCGTCGCTGAACGTCCGCCCCCTG
GTGCGCGAGCATCTGTGGGTGGTCGCGCCCCCGTCCGAGGGGCTGCGCGGCGACCACCCC
GTCCCCTTCGCGCGGGTCGCCGAGCATCCACTGGTCATGCCCGCGGCCGGGCACGCTCTG
CGCAGTCTGATCGACGGGGCCGCCGGCCGGGCCGCGGTCGAGATGGACATCGTCGTACAG
ACCAACTCCATGCGGCTGCAGAAACAGCTCGTCCGGGCCGGCCACGGCTGGACCGTCCTG
CCGGGCGTGGGCATCGCCGAGGACGTGGCCGAGGGCACGCTGAGCGCGGCCCCGCTGTGC
GACCCCGACGTATGGCGCTCGATCGTCCTGGCCACACCGCGCAACGGGCGGACACCACCC
GCGGCCGAGGTCGTCGCCCGGGAGCTGGTCCGCCATATCGCCTCGGCCGTACACCAGGGG
CGATGGCCCTCCGCCCAACTGCACGCGCAGATCGACCGCACCGACGACACATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000847 Transcription regulator HTH, LysR (Domain)
 [4-61]  3.39999999999999e-22 PF00126
PF00126   HTH_1
 [1-58]  PS50931
PS50931   HTH_LYSR
 [18-29]  1.39999892049878e-10 PR00039 [29-39]  1.39999892049878e-10 PR00039 [39-50]  1.39999892049878e-10 PR00039
PR00039   HTHLYSR
IPR005119 LysR, substrate-binding (Domain)
 [89-292]  1.2e-41 PF03466
PF03466   LysR_substrate
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [1-83]  6.40000000000001e-28 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-21]  0.252 Signal
Eukaryota   
TMHMM No significant hit