close all open/close all

CDS information : Meili_00590


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction126,703 / 127,887 / + [in whole cluster]
126,703 / 127,887 / + [in contig]
Location126703..127887 [in whole cluster]
126703..127887 [in contig]
TypeCDS
Length1,185 bp (394 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)L-carnitine dehydratase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf50

close this sectionSequence

selected fasta
>[L-carnitine dehydratase]
MTEPPLSGITVVSVEQAVAAPFATRQLADLGARVIKVERPGGGDFARRYDTTVHGESSYF
VWLNRSKESLTLDLKSARGRDILGRLLGEADVFVQNLAPGAATRLGLGADALTERHPALI
PCTISGYGTSGPWADRKAYDLLVQCQTGLVSLTGNEHGSARVGVSIADIAAGMYAYSGIL
TALFTRATSGVARPVEVSLFEALAEWLSQPAYYTRHGGTQPPRLGTRHATIAPYGAYPAA
DGGEVLFSVQNEREWTALCERFLDRPELVDDPRFATGPARVAHRRELDAIVAERFRTLAS
GEAMELLDAAGIANAGVNSVEQFLGHPVLDARGRWRDVRIPGAVVPALLPPVDLAGVTPR
MDAVPAVGEHTDTILAGLGHSAADIDTLRAEHVI
selected fasta
>[L-carnitine dehydratase]
ATGACCGAGCCGCCACTCTCCGGCATCACCGTCGTCAGCGTCGAGCAGGCGGTGGCGGCC
CCGTTCGCCACCCGCCAGCTGGCCGACCTCGGCGCCCGGGTAATCAAGGTGGAGCGCCCG
GGCGGGGGCGACTTCGCCCGCCGGTACGACACCACGGTGCACGGCGAGTCCAGCTACTTC
GTATGGCTCAACCGGTCGAAGGAATCCCTGACCCTGGACCTGAAGTCGGCGCGCGGCCGG
GACATCCTGGGGCGGCTGCTGGGTGAGGCCGATGTGTTCGTGCAGAACCTCGCGCCGGGC
GCGGCCACCCGGCTGGGCCTGGGCGCGGACGCCCTCACCGAGCGCCACCCCGCCCTCATC
CCGTGCACCATCTCCGGCTATGGCACCAGCGGGCCGTGGGCCGACCGGAAGGCGTACGAC
CTGCTGGTGCAGTGCCAGACCGGTCTGGTCTCGCTCACCGGCAACGAACACGGCTCCGCC
CGGGTGGGGGTGTCGATCGCCGACATCGCGGCCGGGATGTACGCGTACTCGGGGATCCTC
ACCGCGCTCTTCACCCGCGCGACCAGCGGCGTCGCCCGCCCCGTGGAGGTGTCCCTGTTC
GAGGCGCTGGCCGAGTGGCTGAGCCAGCCCGCGTACTACACCCGCCACGGCGGCACCCAG
CCGCCGCGGCTCGGCACCCGGCACGCCACCATCGCCCCGTACGGCGCGTATCCGGCCGCC
GACGGCGGGGAAGTCCTCTTCTCGGTCCAGAACGAGCGGGAGTGGACCGCGCTGTGCGAG
CGGTTCCTGGACCGGCCGGAGCTGGTGGACGACCCTCGGTTCGCCACCGGACCGGCCCGG
GTGGCCCATCGCCGGGAGCTCGACGCGATCGTAGCCGAGCGGTTCCGCACCCTGGCGAGC
GGGGAGGCGATGGAGCTGCTGGACGCGGCGGGCATCGCCAACGCGGGGGTGAACAGCGTC
GAGCAGTTCCTCGGCCATCCCGTGCTGGACGCCCGCGGCCGCTGGCGCGACGTACGCATC
CCGGGGGCCGTGGTGCCCGCGCTGCTGCCGCCCGTGGACCTCGCCGGGGTCACCCCCCGT
ATGGACGCGGTCCCGGCCGTCGGCGAGCACACCGACACGATCCTCGCCGGGCTGGGACAC
AGCGCGGCCGATATCGACACCCTCCGGGCCGAGCACGTCATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003673 CoA-transferase family III (Family)
 [70-258]  2.89999999999999e-60 PF02515
PF02515   CoA_transf_3
IPR023606 CoA-transferase family III domain (Domain)
 [3-314]  4.49999999999996e-99 G3DSA:3.40.50.10540
G3DSA:3.40.50.10540   CoA-Trfase_fam_III
 [2-394]  8.19994104549874e-125 SSF89796
SSF89796   CoA-Trfase_fam_III
SignalP
 [1-28]  0.295 Signal
Bacteria, Gram-positive   
 [1-19]  0.587 Signal
Eukaryota   
 [1-28]  0.173 Signal
Bacteria, Gram-negative   
TMHMM No significant hit