close all open/close all

CDS information : Meili_00600


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction127,932 / 129,095 / + [in whole cluster]
127,932 / 129,095 / + [in contig]
Location127932..129095 [in whole cluster]
127932..129095 [in contig]
TypeCDS
Length1,164 bp (387 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)acyl-CoA dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf51

close this sectionSequence

selected fasta
>[acyl-CoA dehydrogenase]
MSTLDILSEDEQFIVSTVRDFVDKDVKPVVQALEHANTYPEALIEQMKRLGIFGLAVPEE
YGGTPVSTPCYVLITEELARGWMSLAGAMGGHTVVGKLLLHFGTEEQKRHYLPRMATGEI
RATMALTEPGGGSDLQAMRTVARRAADGYVVSGSKTWITNSRRSQLIALLCKTDPDATPA
HQGVSILLAEHGPGLTVSRDLPKLGYKGVESCELSFDGYRAAADAVLGGVEGKGFAQMMK
GLETGRLQVAARALGVGRAAFEDALAYAQERESFGTPIWKHQSIGNYLADMATSLTAARQ
LTLYAAREADAGRRVDMEAGMAKLFASETAMQIALNAVRIHGGYGYSTEFDVERYFRDAP
LMIVGEGTNEIQRNVIAAQLVKRGGLE
selected fasta
>[acyl-CoA dehydrogenase]
ATGAGCACCCTCGATATCCTGTCCGAGGACGAGCAGTTCATCGTCAGTACGGTGCGCGAC
TTCGTCGACAAGGACGTGAAACCGGTCGTCCAGGCCCTCGAACACGCCAACACCTACCCC
GAGGCCCTGATCGAGCAGATGAAGCGGCTCGGCATCTTCGGGCTCGCCGTCCCCGAGGAG
TACGGCGGCACCCCCGTCTCCACCCCCTGCTACGTCCTGATCACCGAAGAACTCGCCCGC
GGCTGGATGAGCCTGGCGGGCGCGATGGGCGGCCACACCGTCGTCGGCAAGTTGCTGCTG
CACTTCGGCACCGAAGAGCAGAAGCGCCACTACCTGCCGAGGATGGCCACCGGCGAGATC
CGGGCCACCATGGCGCTCACCGAGCCGGGCGGCGGCTCCGACCTCCAGGCCATGCGCACC
GTCGCCCGCAGGGCGGCGGATGGCTATGTGGTCAGCGGTTCGAAGACCTGGATCACCAAC
TCCCGCCGCTCCCAGCTCATCGCCCTGCTGTGCAAGACCGACCCCGATGCCACCCCCGCG
CACCAGGGCGTCTCCATCCTGCTGGCCGAGCACGGGCCCGGTCTGACGGTCTCGCGCGAT
CTGCCCAAGCTCGGCTACAAGGGTGTGGAGAGCTGTGAGCTCTCCTTCGACGGTTACCGG
GCAGCGGCTGATGCCGTGCTGGGCGGTGTCGAGGGCAAGGGGTTCGCCCAGATGATGAAG
GGGCTGGAGACCGGCAGGCTCCAGGTCGCCGCCCGTGCGCTCGGGGTCGGCCGGGCGGCG
TTCGAGGACGCGCTGGCCTACGCGCAGGAGCGCGAGTCGTTCGGCACACCGATCTGGAAA
CACCAGTCGATCGGCAACTACCTTGCCGACATGGCCACCTCGCTGACCGCGGCGCGCCAG
CTCACCCTGTACGCGGCGCGCGAGGCCGACGCGGGCCGGCGCGTGGACATGGAGGCGGGC
ATGGCGAAGCTGTTCGCCTCCGAGACCGCCATGCAGATCGCGCTCAACGCCGTTCGTATC
CACGGCGGTTACGGCTACTCCACGGAGTTCGACGTGGAGCGTTACTTCCGCGACGCGCCC
CTGATGATCGTCGGTGAGGGCACCAACGAGATCCAGCGCAATGTGATCGCGGCTCAGCTC
GTCAAGCGAGGAGGACTGGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006089 Acyl-CoA dehydrogenase, conserved site (Conserved_site)
 [125-137]  PS00072
PS00072   ACYL_COA_DH_1
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [232-380]  6.00000000000001e-46 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [123-174]  2.80000000000001e-18 PF02770
PF02770   Acyl-CoA_dh_M
 [123-219]  8.70000000000003e-31 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [8-119]  6.50000000000001e-32 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [220-384]  9.29999999999998e-60 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [232-382]  3.39999972437719e-51 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-231]  3.699978135861e-70 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [7-120]  3.40000000000004e-38 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit