close all open/close all

CDS information : Meili_00610


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction132,380 / 129,165 / - [in whole cluster]
132,380 / 129,165 / - [in contig]
Locationcomplement(129165..132380) [in whole cluster]
complement(129165..132380) [in contig]
TypeCDS
Length3,216 bp (1,071 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)rhamnosidase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf52

close this sectionSequence

selected fasta
>[rhamnosidase]
MISRRNLLGTATAAGPALTGLTALAATTGKAEAAEPGYGGLRVEKTTVEYADRPLGLDAP
HPRLSWQLGSDRSNQSQSAYQVRVATSPGRIGAPDVWDSGKVSSHQSVLVPYDGPKPRAR
TRYHWAVRVWDGQGRPSPWSEPTWWETGLGTEDEGAARWVAAPDTVTRGPDLAKADWVWY
PEGDPASNAPAGTRYFRGSFEVSGSVRLARLALVADDGFTAWVNGTEIGGRAPVQENWRH
PVVVDVTALLREGANTIAVAAVNASSSPAGLLGVLELTDADGVRSVTTSAAWKATDAEPS
GDWRLPAYDDGAWAAAKVLAPWGGGPWGRVRAAQRPALVRRDFRLAAKPVARARLYSTAL
GLYEAEINGHRVGRDQLAPGWTDYRKRVQYQTYDVTDLLRRGANAIGVIVASGWYSGSVA
WLGQEQYGERPALRAELEVTYADGSTDRVTTDTHWRCATGPILTADLMAGEEYDARLEAS
GWSSPAFDDALWQSVDVVPADTTSALSVVAQTDAPIRVARELAAVRVTEPKPGVYVFDLG
QNMVGSVRLRVSGEAGRTVRLRHAEVLDKDGMLYTANLRTAQATDSYTLKGSGTETFEPR
FTFHGFRYVEVTGYPGTPDTKAVTGRVMHTGAPFTMSFTTDVPMLNQLHRNITWGQRGNF
LSVPTDTPARDERLGWTGDINVFSATAAYTMESARFLAKWLRDLRDGQSDAGAFPDVAPR
IGNLGEGTAGWGDAGVTVPWNLYQAYGDRQILADNFPAMRAWITYLEQHSSGYLRPAEGY
GDWLNVADETPKDVIATAYFAHSTQLVAKAARVLGHGPAPYDTLAAKVREAFNRAYVSAD
GTVKGDTQTAYVLALSMDLLPDSARTPAADRLVELIRSKDGHLSTGFLGTPRLLPTLTAT
GHTDVAYQLLEQRTFPSWGYQIDRGSTTMWERWDSLRPDGSFQDPGMNSFNHYAYGSVGE
WMYQNITGIGMGEPGFRSIVIRPRPGGDVHEANGRYDSLYGPITTRWTRAKDGAFTLDVS
VPVNTDAEVWLPAATSRAASGISHAGAAFLRLDDGCAVYGVGSGSYRFTAP
selected fasta
>[rhamnosidase]
GTGATCAGCAGAAGGAACCTCCTCGGCACCGCCACCGCTGCGGGCCCCGCCCTGACGGGC
CTGACCGCCCTCGCGGCAACCACCGGGAAAGCCGAGGCAGCCGAGCCCGGATACGGCGGG
CTCCGGGTCGAGAAGACCACCGTGGAATACGCCGACCGCCCGCTCGGCCTGGACGCCCCG
CACCCTCGCCTCAGCTGGCAGCTCGGCTCGGACCGCAGCAACCAGTCGCAGAGCGCGTAC
CAGGTGCGCGTCGCGACCTCTCCGGGCCGGATCGGCGCCCCGGACGTCTGGGACAGCGGC
AAGGTGAGCTCCCACCAGTCCGTTCTGGTCCCGTACGACGGCCCGAAGCCGCGCGCCCGG
ACCCGTTACCACTGGGCCGTCCGGGTCTGGGACGGCCAGGGCCGGCCCTCGCCCTGGAGC
GAGCCCACGTGGTGGGAGACCGGTCTTGGCACCGAGGACGAGGGGGCGGCGAGGTGGGTT
GCCGCGCCGGACACGGTGACCCGGGGTCCCGATCTGGCCAAGGCCGACTGGGTTTGGTAC
CCCGAGGGCGACCCGGCATCCAACGCGCCCGCCGGGACCCGGTACTTCCGGGGCTCCTTC
GAGGTGTCCGGAAGTGTGCGGCTCGCCCGTCTGGCGCTGGTCGCCGACGACGGGTTCACC
GCATGGGTCAACGGCACCGAGATCGGGGGGCGCGCTCCCGTTCAGGAGAACTGGCGCCAT
CCGGTGGTCGTCGATGTCACCGCCCTGCTCCGCGAAGGGGCCAACACCATCGCCGTCGCC
GCGGTCAACGCCTCGTCGAGCCCCGCCGGACTGCTGGGTGTCCTGGAGCTGACCGACGCG
GACGGTGTCCGTTCCGTCACCACCTCCGCCGCCTGGAAGGCCACCGACGCGGAGCCGTCC
GGTGACTGGCGCCTGCCCGCATACGACGACGGCGCCTGGGCCGCCGCCAAGGTGCTCGCC
CCGTGGGGCGGCGGGCCCTGGGGCAGGGTCCGGGCGGCGCAGCGGCCCGCCCTGGTGCGC
CGCGACTTCCGGCTCGCCGCGAAGCCCGTCGCGCGGGCGCGGCTGTACTCGACGGCACTG
GGGCTGTACGAGGCCGAGATCAACGGCCACCGCGTCGGCCGGGACCAGCTCGCCCCCGGC
TGGACCGACTACCGCAAGCGCGTCCAGTACCAGACGTACGACGTCACCGATCTGCTCCGG
CGCGGCGCCAACGCCATCGGTGTGATCGTCGCCTCCGGCTGGTACTCCGGCAGCGTCGCG
TGGCTCGGGCAGGAGCAGTACGGCGAGCGGCCCGCTCTGCGGGCGGAGCTCGAGGTCACG
TACGCCGACGGCAGCACCGACCGCGTCACCACCGACACGCACTGGCGCTGCGCCACGGGC
CCGATCCTGACCGCCGACCTGATGGCCGGAGAGGAGTACGACGCCCGGCTGGAAGCGTCC
GGCTGGTCCTCTCCCGCGTTCGACGACGCCCTCTGGCAATCCGTCGACGTGGTGCCGGCC
GACACCACATCCGCCCTCTCCGTGGTGGCCCAGACGGATGCCCCGATCCGGGTGGCGAGG
GAGCTGGCCGCCGTCCGCGTCACCGAGCCCAAGCCCGGTGTGTACGTCTTCGACCTGGGC
CAGAACATGGTGGGCTCGGTGCGGCTGCGGGTGAGTGGCGAGGCCGGGCGGACCGTGCGG
CTGCGCCACGCCGAGGTCCTGGACAAGGACGGCATGCTCTACACCGCCAATCTGCGCACC
GCCCAGGCGACCGACTCGTACACCCTGAAGGGCTCGGGGACGGAGACGTTCGAACCGCGC
TTCACCTTCCACGGCTTCCGCTATGTCGAGGTCACCGGCTATCCCGGCACCCCGGACACA
AAGGCCGTCACCGGGCGCGTCATGCACACCGGAGCCCCCTTCACCATGTCGTTCACGACC
GATGTGCCCATGCTCAACCAACTGCACCGCAACATCACCTGGGGCCAGCGGGGCAACTTC
CTGTCCGTCCCCACCGACACTCCGGCCCGCGACGAACGGCTCGGGTGGACGGGGGACATC
AACGTCTTCTCCGCCACCGCCGCCTACACCATGGAATCCGCCCGCTTCCTCGCCAAGTGG
CTCCGGGATCTGCGCGACGGGCAGTCCGACGCCGGCGCGTTCCCCGACGTCGCGCCCCGT
ATCGGCAACCTCGGCGAGGGCACGGCCGGCTGGGGCGACGCCGGCGTCACCGTGCCGTGG
AACCTCTACCAGGCCTATGGGGACCGGCAGATACTGGCGGACAACTTTCCCGCGATGCGG
GCCTGGATCACATATCTGGAGCAGCACAGCAGCGGCTATCTGCGGCCTGCGGAGGGGTAC
GGCGACTGGCTCAACGTGGCCGACGAGACCCCCAAGGACGTCATCGCCACCGCGTACTTC
GCGCACAGCACACAGCTGGTCGCCAAGGCCGCGAGGGTGCTGGGTCACGGCCCCGCGCCG
TACGACACGCTGGCCGCGAAGGTCCGCGAGGCGTTCAACCGGGCGTATGTGTCCGCCGAC
GGCACCGTCAAGGGCGACACCCAGACGGCTTACGTCCTGGCGCTGTCCATGGACCTGCTG
CCGGACAGCGCGCGAACACCCGCCGCCGACCGGCTCGTCGAGCTGATCCGAAGCAAGGAC
GGGCATCTGTCCACCGGCTTCCTCGGCACCCCGCGCCTGCTGCCCACGCTCACCGCCACC
GGCCACACCGACGTCGCCTACCAGCTGCTGGAACAGCGGACGTTCCCCTCCTGGGGATAT
CAGATCGACCGGGGCTCGACGACGATGTGGGAGCGCTGGGACTCCCTCAGGCCCGATGGG
AGCTTCCAGGATCCCGGTATGAACTCGTTCAACCACTACGCCTACGGCTCCGTCGGCGAG
TGGATGTACCAGAACATCACCGGCATCGGCATGGGCGAGCCCGGCTTCCGCAGCATCGTC
ATCCGGCCTCGCCCCGGCGGTGACGTACACGAGGCGAACGGGCGCTACGACTCTCTCTAC
GGCCCGATCACCACCCGGTGGACGCGGGCGAAAGACGGCGCGTTCACGCTGGACGTGTCC
GTGCCGGTCAATACGGACGCCGAGGTATGGCTGCCCGCCGCCACCTCCCGCGCCGCGTCC
GGGATCAGCCACGCCGGGGCGGCCTTCCTGCGCCTCGACGACGGCTGCGCCGTCTACGGC
GTGGGCTCCGGCTCGTATCGCTTCACCGCCCCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-33]  PS51318
PS51318   TAT
IPR008902 Bacterial alpha-L-rhamnosidase (Domain)
 [528-1031]  PF05592
PF05592   Bac_rhamnosid
IPR008928 Six-hairpin glycosidase-like (Domain)
 [635-1032]  2.69998997787809e-47 SSF48208
SSF48208   Glyco_trans_6hp
IPR008979 Galactose-binding domain-like (Domain)
 [176-264]  1.19999985703101e-08 SSF49785
SSF49785   Gal_bind_like
IPR013737 Bacterial alpha-L-rhamnosidase N-terminal (Domain)
 [348-519]  9.29999999999998e-64 PF08531
PF08531   Bac_rhamnosid_N
IPR013783 Immunoglobulin-like fold (Domain)
 [63-147]  3e-05 G3DSA:2.60.40.10
G3DSA:2.60.40.10   Ig-like_fold
IPR016007 Alpha-L-rhamnosidase (Family)
 [1-1070]  PIRSF010631
PIRSF010631   A-rhamnsds
SignalP
 [1-25]  1 Signal
Bacteria, Gram-negative   
 [1-33]  1 Signal
Bacteria, Gram-positive   
 [1-33]  0.991 Signal
Eukaryota   
TMHMM No significant hit