close all open/close all

CDS information : Meili_00620


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction132,940 / 132,620 / - [in whole cluster]
132,940 / 132,620 / - [in contig]
Locationcomplement(132620..132940) [in whole cluster]
complement(132620..132940) [in contig]
TypeCDS
Length321 bp (106 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf53

close this sectionSequence

selected fasta
>[hypothetical protein]
MEHPAMAEVSLQQVLDALVDPVRRAVVSQLARADEDISCGTFDVSVSRSTLTHHFNVLRQ
AGVIRQYYVGTTKMNTLRTDEMEGRFPGLLSALVAASAPETGVSAR
selected fasta
>[hypothetical protein]
GTGGAGCACCCTGCCATGGCGGAGGTCTCGTTGCAGCAGGTGCTGGACGCCCTGGTGGAT
CCGGTGCGGCGCGCCGTGGTGTCCCAACTGGCCCGCGCCGATGAGGACATCAGCTGCGGG
ACCTTCGATGTGTCGGTGTCCCGGTCCACGCTGACGCACCACTTCAATGTGTTGCGGCAG
GCGGGGGTGATCCGGCAGTACTACGTCGGGACGACGAAGATGAACACGCTCCGCACGGAC
GAGATGGAGGGGCGCTTCCCGGGCCTGCTGTCGGCGCTGGTGGCCGCATCCGCCCCGGAG
ACAGGCGTCTCCGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001845 HTH ArsR-type DNA-binding domain (Domain)
 [15-30]  6.09999977126211e-05 PR00778 [47-62]  6.09999977126211e-05 PR00778
PR00778   HTHARSR
 [3-97]  PS50987
PS50987   HTH_ARSR_2
 [13-91]  4.00000300869883e-14 SM00418
SM00418   HTH_ARSR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [4-90]  1.3e-13 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit