close all open/close all

CDS information : Meili_00630


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction133,751 / 133,101 / - [in whole cluster]
133,751 / 133,101 / - [in contig]
Locationcomplement(133101..133751) [in whole cluster]
complement(133101..133751) [in contig]
TypeCDS
Length651 bp (216 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf54

close this sectionSequence

selected fasta
>[transcriptional regulator]
MSPARRRGLAEEVADRIREAIFNGAYAPGAQLREVELSGVMDVSRGPVREALRILEREGL
VRCAWHRGTVVTTLSSEDVAELESLCGALERLAVERIIAHASEEDFVSLEKAAGLMERAR
DEHEMVRLDIGFHDAVFATSGHQRLAEAWEAIRCQVHLFLLTRIGHSTEGYLTRVPEEHR
ELVAALRSRDVHGALDLFAAHRRVAVDVVGAERVPS
selected fasta
>[transcriptional regulator]
GTGTCCCCGGCGCGGCGTCGTGGTCTTGCCGAGGAGGTGGCGGACCGGATCCGGGAGGCG
ATCTTCAACGGAGCCTACGCCCCTGGTGCGCAGCTGCGTGAGGTGGAGCTGTCGGGTGTG
ATGGACGTCAGCCGTGGCCCCGTGCGGGAGGCGCTGCGGATCCTGGAGCGCGAGGGCCTG
GTCCGGTGTGCCTGGCACCGCGGCACGGTGGTGACCACCCTGTCGTCCGAGGACGTGGCG
GAGCTGGAGAGTCTGTGTGGCGCGCTGGAGCGGCTGGCCGTCGAGCGGATCATCGCTCAT
GCCTCGGAGGAGGACTTCGTGTCCCTGGAGAAGGCGGCGGGGCTGATGGAGCGCGCGCGG
GACGAGCACGAGATGGTCCGTCTGGACATTGGATTCCATGACGCGGTTTTCGCCACTTCC
GGCCATCAGCGTCTGGCGGAGGCGTGGGAGGCCATCCGCTGTCAGGTCCATCTGTTTCTG
CTGACCCGGATCGGTCACAGCACCGAGGGCTACCTCACCCGGGTCCCCGAGGAGCACCGC
GAGCTCGTCGCCGCGCTGCGGTCGCGTGATGTTCATGGCGCGCTCGACCTGTTCGCCGCC
CACCGCCGCGTCGCCGTCGACGTGGTCGGCGCGGAGCGCGTTCCGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000524 Transcription regulator HTH, GntR (Domain)
 [9-71]  3.8e-17 PF00392
PF00392   GntR
 [13-71]  9.10000425645573e-19 SM00345
SM00345   HTH_GNTR
 [7-74]  PS50949
PS50949   HTH_GNTR
IPR011711 GntR, C-terminal (Domain)
 [82-201]  3.39999999999999e-18 PF07729
PF07729   FCD
 [81-204]  1.59999889349252e-10 SM00895
SM00895   FCD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [2-72]  5.30000000000001e-23 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit