close all open/close all

CDS information : Meili_00640


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction133,941 / 134,603 / + [in whole cluster]
133,941 / 134,603 / + [in contig]
Location133941..134603 [in whole cluster]
133941..134603 [in contig]
TypeCDS
Length663 bp (220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf55

close this sectionSequence

selected fasta
>[hypothetical protein]
MVAVAGCGGGGRGGSRAAESDRPSEPQRTSAAPSPSAPSPSASSPSAPAAIRLSPADLQG
RWWTWAASEETSTNPVADEDGRSCHRNQPDDVWFLAGTFGGQVERTCTVPSGRPVAFPLI
NLVGDAADCADFMETASGTASLDGRDISPDRYLGTTITGTAAPGNPVTDSSGRFSGTGCG
LWVQLPPLKAGKHTLKIRGRSADFTVAVDYALTVAAPSTV
selected fasta
>[hypothetical protein]
GTGGTCGCGGTCGCCGGATGCGGCGGAGGGGGCCGCGGCGGATCGCGGGCCGCGGAGTCC
GACCGGCCATCGGAACCGCAGCGGACGTCAGCGGCGCCCTCCCCATCGGCACCGTCGCCC
TCGGCTTCCTCACCCTCGGCACCGGCCGCCATCCGGCTCTCCCCCGCGGATCTGCAGGGG
CGGTGGTGGACATGGGCGGCGTCGGAAGAGACGTCGACGAACCCGGTCGCCGACGAGGAC
GGGCGGTCGTGCCACCGTAACCAGCCGGACGATGTGTGGTTTCTGGCCGGGACCTTCGGC
GGGCAGGTCGAACGGACCTGCACCGTGCCAAGTGGCCGCCCCGTCGCCTTTCCCCTCATC
AACCTCGTGGGCGACGCGGCGGACTGCGCCGACTTCATGGAAACGGCCTCGGGCACGGCG
AGCCTGGACGGCCGGGACATCAGCCCGGATCGCTACCTCGGGACGACGATCACGGGGACG
GCCGCGCCCGGAAACCCCGTGACCGATTCGAGCGGCCGGTTCAGCGGGACGGGGTGCGGG
CTGTGGGTTCAGCTGCCCCCACTCAAGGCCGGGAAGCACACGTTGAAGATCCGGGGCAGG
TCCGCAGACTTCACGGTCGCGGTGGACTACGCGTTGACCGTGGCGGCGCCCAGCACCGTC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-17]  0.363 Signal
Bacteria, Gram-negative   
TMHMM No significant hit