close all open/close all

CDS information : Meili_00650


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction135,198 / 134,605 / - [in whole cluster]
135,198 / 134,605 / - [in contig]
Locationcomplement(134605..135198) [in whole cluster]
complement(134605..135198) [in contig]
TypeCDS
Length594 bp (197 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)TetR-family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf56

close this sectionSequence

selected fasta
>[TetR-family transcriptional regulator]
MNDSDEGAGRAARSKRADARRNQETLLDAAAAVFVASGVEAPVRDIAAKAGVGVGTIYRH
FPTRADLIIAVYRHQVEACAEAGPALLASSATPHAALGQWIDLFVDFLVTKHGLAAVLQS
DNAGFETLHAYFLDRLVPVCTQLLDAAVDSGEIRSDVEAIQLMRGVGNLCIGAEHNPHYD
ARRLVELLIAGLRLPPG
selected fasta
>[TetR-family transcriptional regulator]
GTGAACGACAGCGACGAGGGCGCGGGACGCGCGGCCCGGTCCAAGCGGGCGGACGCCCGG
CGCAACCAGGAGACGCTGCTCGACGCGGCCGCCGCGGTCTTCGTCGCGTCAGGCGTGGAA
GCGCCGGTACGTGACATCGCGGCCAAGGCCGGCGTCGGGGTGGGCACGATCTACCGCCAC
TTCCCGACGCGAGCGGATCTGATCATCGCTGTCTACCGGCACCAGGTCGAGGCATGCGCC
GAGGCCGGTCCTGCCCTGCTGGCGAGCAGCGCGACCCCGCACGCCGCGCTCGGGCAGTGG
ATCGACCTCTTCGTCGATTTCCTGGTCACCAAGCACGGACTCGCCGCCGTGCTGCAGTCC
GACAACGCGGGCTTCGAGACGCTGCACGCCTACTTCCTCGACCGCCTCGTGCCCGTGTGC
ACCCAACTGCTCGACGCCGCGGTCGATTCCGGCGAGATCCGATCCGACGTGGAGGCCATC
CAGCTCATGCGCGGCGTCGGAAACCTCTGCATCGGCGCCGAGCACAACCCCCACTACGAC
GCACGACGACTGGTCGAACTCCTCATCGCGGGGCTGCGCCTGCCGCCTGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [26-71]  8.80000000000003e-13 PF00440
PF00440   TetR_N
 [20-79]  PS50977
PS50977   HTH_TETR_2
 [26-39]  6.09999977126211e-09 PR00455 [46-69]  6.09999977126211e-09 PR00455
PR00455   HTHTETR
IPR009057 Homeodomain-like (Domain)
 [10-97]  2.90000354677981e-18 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [92-195]  9.20000434662057e-08 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [15-195]  4.39999999999997e-40 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit