close all open/close all

CDS information : Meili_00660


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction135,388 / 136,407 / + [in whole cluster]
135,388 / 136,407 / + [in contig]
Location135388..136407 [in whole cluster]
135388..136407 [in contig]
TypeCDS
Length1,020 bp (339 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)aldoketoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf57

close this sectionSequence

selected fasta
>[aldoketoreductase]
MQYRTLGRTGVQVSSLALGAMNFGRIGRTTQDEATAIVDAALEGGINLIDTADMYSAGES
EEMVGKAIAGRRDDIVLATKAGMPMGDERNHRGSSRRWLVAELDNSLRRLGVDHVDLYQI
HRWDPNTSDEETLSALTDLQRAGKIRHFGSSTFPAYRIVQAQWAAREHHLSRYVTEQPSY
SILQRGIESHVLPVTEQYGLGVLVWSPLASGWLSGAIREGREIATSRSTFMPERFDTTVP
ANRARLDAVERLAEVADEAGLTMIQLALGFVTAHPAVTSALIGPRTLDHLHTQLAAADTV
LSADVLDAIDAIVAPGVDLAAHEKHDTPPALLDPSLRRR
selected fasta
>[aldoketoreductase]
ATGCAGTACCGCACCTTGGGCCGCACCGGTGTGCAGGTCAGCTCTCTCGCGCTCGGCGCC
ATGAACTTCGGCAGGATCGGGCGCACCACCCAGGACGAGGCCACCGCCATCGTCGACGCC
GCTCTCGAGGGCGGGATCAACCTCATCGACACCGCCGACATGTACAGCGCGGGCGAGTCG
GAAGAGATGGTCGGCAAAGCCATCGCCGGCCGCCGCGACGACATCGTGCTGGCCACGAAG
GCGGGCATGCCGATGGGCGACGAGCGCAACCATCGGGGCAGTTCGCGCCGCTGGCTGGTC
GCCGAACTGGACAACAGCCTGCGCCGGCTCGGTGTCGACCACGTCGATCTCTACCAGATC
CACCGCTGGGACCCGAACACCAGCGACGAGGAGACGCTGTCGGCGCTCACCGACCTCCAG
CGTGCCGGAAAGATCCGCCACTTCGGGTCGTCGACGTTTCCCGCCTACCGCATCGTGCAG
GCCCAGTGGGCTGCCCGCGAGCACCACCTGAGCCGCTATGTCACCGAGCAGCCCAGCTAC
TCGATCCTGCAGCGCGGTATCGAGAGCCATGTGCTGCCCGTGACCGAGCAGTACGGGCTC
GGTGTGCTGGTGTGGAGCCCGCTGGCCTCTGGCTGGCTGTCGGGCGCGATCCGCGAGGGC
CGGGAGATCGCCACCAGCCGCTCGACGTTCATGCCGGAACGCTTCGACACCACCGTTCCC
GCCAACCGGGCCAGGCTCGACGCCGTCGAGCGGCTGGCCGAGGTGGCCGACGAGGCCGGT
CTGACAATGATCCAGCTCGCGCTCGGATTCGTGACCGCGCATCCCGCCGTGACCAGCGCG
CTCATCGGCCCCCGCACCCTGGACCATCTGCACACGCAACTCGCCGCCGCCGACACCGTG
CTCTCGGCCGATGTGCTCGACGCCATCGACGCGATCGTCGCGCCCGGTGTCGACCTGGCC
GCGCACGAGAAGCACGACACTCCGCCCGCGCTGCTCGACCCGTCGCTGCGGCGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [1-315]  2.39999798157263e-95 SSF51430
SSF51430   Aldo/ket_red
 [16-313]  4.09999999999995e-71 PF00248
PF00248   Aldo_ket_red
 [1-313]  2.70000000000002e-92 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
SignalP No significant hit
TMHMM No significant hit