close all open/close all

CDS information : Meili_00670


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction136,478 / 137,323 / + [in whole cluster]
136,478 / 137,323 / + [in contig]
Location136478..137323 [in whole cluster]
136478..137323 [in contig]
TypeCDS
Length846 bp (281 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)flavin-dependent oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf58

close this sectionSequence

selected fasta
>[flavin-dependent oxidoreductase]
MQVDYHDVLRVWREADTIPEIEHAWLFDHLMPIGGDPNGPAYEGWTLLSALAAHTRRLRL
GLLVTSNRFRPPAMLAKIATTVDIVSGGRLDFGIGVGSRPNPPAAHREYAAHGLPFHDTA
HAVGSLAEACTVIRRLWTEQEPFDFDGTYHQLTGAFGNPKPVQRPHPPILIGGRSAPTLR
VAAEHADLWNIPGGDIDDVVSRSALLDRYCAEIGRDPASITRSIHLPVSYDRPGATRDAI
GEAIDAGFPHIVLGLPVPYPVNVARWVADELINTSARGESS
selected fasta
>[flavin-dependent oxidoreductase]
ATGCAGGTCGACTACCACGACGTCCTGCGGGTCTGGCGCGAGGCGGACACCATCCCGGAG
ATCGAGCACGCCTGGTTGTTCGATCACCTCATGCCGATCGGCGGCGACCCGAACGGACCG
GCGTACGAAGGCTGGACTCTGCTCTCGGCCCTCGCTGCCCACACCCGACGCCTACGGCTC
GGCCTGCTGGTGACCAGCAACCGGTTCCGGCCGCCCGCGATGCTGGCCAAGATCGCCACG
ACTGTGGACATCGTCTCCGGTGGACGGCTCGACTTCGGCATCGGTGTCGGCTCACGCCCC
AACCCTCCCGCGGCCCACCGCGAGTACGCGGCACACGGCCTGCCCTTCCATGACACCGCG
CACGCCGTGGGGAGCCTCGCCGAGGCCTGTACGGTGATCCGGCGGCTGTGGACCGAGCAG
GAGCCGTTCGACTTCGACGGCACCTACCACCAGCTCACCGGGGCGTTCGGCAACCCCAAA
CCCGTCCAGCGCCCCCATCCGCCGATCCTCATCGGCGGACGCTCGGCCCCGACGCTGCGC
GTGGCCGCCGAACACGCCGATCTGTGGAACATCCCCGGCGGCGACATCGACGACGTCGTG
AGCCGCAGTGCGCTGCTGGACCGCTACTGCGCCGAGATCGGTCGCGACCCCGCCTCGATC
ACCCGCTCGATCCACCTGCCCGTCTCGTACGACCGGCCCGGCGCCACCCGGGACGCGATC
GGCGAGGCGATCGACGCCGGTTTCCCGCACATCGTCCTCGGACTGCCTGTGCCCTACCCC
GTCAACGTGGCGCGGTGGGTCGCCGACGAGCTCATCAACACCTCGGCCCGGGGCGAGTCC
TCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [4-272]  2.50000909916183e-54 SSF51679
SSF51679   Luciferase_like
 [4-252]  1.80000000000002e-63 G3DSA:3.20.20.30
G3DSA:3.20.20.30   Luciferase_like
 [4-235]  4.80000000000003e-51 PF00296
PF00296   Bac_luciferase
SignalP No significant hit
TMHMM No significant hit