close all open/close all

CDS information : Meili_00680


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction138,866 / 137,355 / - [in whole cluster]
138,866 / 137,355 / - [in contig]
Locationcomplement(137355..138866) [in whole cluster]
complement(137355..138866) [in contig]
TypeCDS
Length1,512 bp (503 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf59

close this sectionSequence

selected fasta
>[hydrolase]
MSTSKPGTDLRRLALSVLQPGFVGTEAPEWILRDIGNGLASVVIFSRNIESPDQLARLTA
QLRAENPSLIVAIDEEAGDVTRIESATGSTRPGNLALGTVDDTELTESVAADLGRQLRGA
GISLNFAPTVDVNSNPDNPIIGVRSFGADATTVSRHAAAWIRGLQSAGVAACAKHFPGHG
DVAVDSHHGLPSYDADLDRIAAQALPPFRAALDAGVRAVMSGHLLVPAYDPELPATLSRR
ILDGLLRQELGFDGLIVTDAIEMGAVADRYGIDAAAVRAVAAGADAVCVGGESAEEATAQ
LLATALVEAVAAGELAEERLAEASERVRAFAEWSTELGRSAPAGGVDGAIGFVAARRAIR
MTGSVAGSLPLAAPPHVVELVPATNLAIGKETPWGVAAPLSERLPGTTSVRIHPQELRTR
AATLEASALTPASGRPLVVVVRDASRHPWMGGALTDLVTARPDAIVVEMGLPGATAPGAV
HISTHGATTASGVAAAEVLAGTR
selected fasta
>[hydrolase]
ATGTCCACCAGCAAGCCCGGCACGGACCTGCGGCGACTCGCACTCTCCGTCCTGCAACCG
GGGTTCGTGGGCACGGAGGCGCCGGAGTGGATCCTGCGTGACATCGGTAACGGCCTGGCG
TCCGTCGTGATCTTTTCGCGCAATATCGAATCCCCGGACCAGCTCGCCCGGCTGACCGCG
CAACTCCGCGCCGAGAACCCGTCGTTGATCGTGGCGATCGACGAGGAGGCCGGTGATGTC
ACCCGGATCGAGTCCGCGACCGGTTCCACCCGTCCCGGCAATCTCGCCCTCGGGACGGTG
GACGACACCGAGCTGACCGAGTCCGTCGCCGCCGATCTGGGCCGCCAACTGCGTGGAGCG
GGCATCAGCCTCAACTTCGCGCCCACCGTGGACGTCAACTCCAACCCGGACAACCCCATC
ATCGGGGTCAGATCCTTCGGGGCGGACGCCACAACGGTGTCCCGGCACGCCGCTGCGTGG
ATCAGAGGACTCCAGTCGGCCGGGGTCGCCGCCTGCGCCAAACACTTCCCCGGCCATGGG
GACGTGGCCGTCGACTCCCACCACGGCCTGCCCAGTTACGACGCCGACCTCGACCGGATC
GCCGCACAGGCCCTGCCGCCGTTCCGCGCCGCGCTGGACGCGGGGGTCCGCGCGGTCATG
AGCGGCCATCTGCTGGTGCCCGCCTACGACCCGGAGCTGCCCGCCACCCTCAGCCGCCGA
ATCCTCGACGGCCTGCTCCGCCAGGAGCTCGGGTTCGACGGGCTGATCGTCACCGACGCC
ATCGAGATGGGGGCGGTCGCCGACCGCTACGGGATCGACGCGGCCGCGGTGCGCGCCGTC
GCCGCCGGGGCCGACGCCGTCTGCGTCGGCGGGGAGAGCGCCGAGGAGGCCACCGCCCAA
CTGCTCGCCACCGCCCTCGTCGAAGCCGTGGCCGCCGGGGAACTCGCCGAGGAGCGGCTG
GCGGAGGCGTCGGAGCGGGTCCGGGCGTTCGCCGAGTGGTCGACGGAGCTGGGCCGGTCC
GCCCCGGCCGGTGGGGTCGACGGTGCCATCGGCTTCGTCGCCGCCCGCCGGGCCATCCGT
ATGACCGGCTCCGTGGCGGGGTCGCTGCCCCTGGCCGCGCCGCCGCATGTGGTGGAGCTG
GTGCCCGCCACCAACCTGGCCATCGGCAAGGAGACCCCCTGGGGCGTCGCCGCACCGCTG
AGCGAGCGGCTTCCCGGTACGACCTCCGTCCGGATCCATCCGCAGGAGTTGCGGACGCGG
GCAGCCACCCTGGAGGCGTCCGCGCTGACCCCCGCCTCCGGGCGTCCGCTGGTGGTCGTC
GTCAGGGATGCCTCCCGGCACCCATGGATGGGCGGCGCCCTGACGGACCTCGTCACCGCG
CGCCCGGACGCGATCGTCGTGGAGATGGGCCTGCCGGGCGCCACCGCCCCCGGCGCGGTG
CACATCTCCACCCATGGCGCGACCACCGCGTCCGGGGTGGCCGCGGCAGAGGTCCTGGCG
GGGACGAGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001764 Glycoside hydrolase, family 3, N-terminal (Domain)
 [39-330]  1.79999999999997e-88 G3DSA:3.20.20.300
G3DSA:3.20.20.300   Glyco_hydro_3_N
 [56-327]  2.4e-63 PF00933
PF00933   Glyco_hydro_3
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [14-346]  5.10003242202156e-86 SSF51445
SSF51445   Glyco_hydro_cat
SignalP No significant hit
TMHMM No significant hit