close all open/close all

CDS information : Meili_00690


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction139,224 / 140,276 / + [in whole cluster]
139,224 / 140,276 / + [in contig]
Location139224..140276 [in whole cluster]
139224..140276 [in contig]
TypeCDS
Length1,053 bp (350 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf60

close this sectionSequence

selected fasta
>[hypothetical protein]
MYRSPSDVPYFSSDGETYLARTQLRDLTKTHQLRVLSEDDFAFWQTYGYVVVKQAIPASA
ARRLLDFTWDFQGLDPGRPDTWYQDREYRSDLDRELHIYGFVEAYHHQLIWDSRQTQRVY
DAFVDVWDCEELWVSLDRLNLNPPNVKNRDRALIAPTERGFDITLHWDVDTTLSVLPQRV
QGIIALHDTEPELGGFQCCPELFHRFDQWRVLQPADRDPIRPKIDRAEMPVVRPQLEAGD
LLIWNGLLAHGVAPNTSRNGVRAVQYLAMMPALESHEELRRSRVESWRHLTTPTWNGTLL
GDADKPEALRYDTAALDDLGAKLLGLTSWDGRNINQGDRSGGEVACDASA
selected fasta
>[hypothetical protein]
TTGTACCGATCCCCCTCGGACGTCCCCTACTTCAGCTCGGACGGCGAGACATACCTCGCC
CGGACTCAGCTGCGGGACCTCACCAAGACCCACCAGCTGCGTGTGTTGTCCGAGGACGAC
TTCGCCTTCTGGCAGACCTACGGCTACGTCGTGGTGAAGCAGGCGATCCCCGCCTCGGCC
GCGCGCCGGTTACTGGACTTCACCTGGGACTTCCAGGGGCTCGACCCCGGCCGCCCGGAC
ACCTGGTACCAGGACCGCGAGTACCGCTCCGACCTGGACCGTGAGCTGCACATCTACGGA
TTCGTCGAGGCGTACCACCACCAGCTCATCTGGGACAGCCGCCAGACGCAGCGGGTCTAC
GACGCGTTCGTGGACGTATGGGACTGCGAGGAACTGTGGGTCAGCCTGGACCGGCTGAAC
CTGAACCCGCCGAACGTCAAGAACCGCGACCGCGCCCTGATCGCCCCCACGGAGCGGGGG
TTCGACATCACACTGCACTGGGATGTCGACACCACGCTCAGTGTGCTGCCGCAGCGGGTC
CAGGGCATCATCGCCCTCCATGACACCGAGCCGGAGCTCGGCGGCTTCCAGTGCTGCCCC
GAGTTGTTCCACCGGTTCGACCAGTGGCGGGTGCTCCAGCCGGCCGACCGCGATCCGATC
CGGCCCAAGATCGACCGGGCCGAGATGCCCGTCGTACGGCCGCAACTCGAGGCCGGGGAC
CTGCTCATCTGGAACGGGCTGCTGGCCCATGGAGTGGCGCCCAACACCTCGCGGAACGGT
GTGCGGGCGGTCCAGTACCTCGCGATGATGCCCGCCCTCGAATCCCATGAGGAGCTGCGG
CGTTCACGGGTCGAGTCATGGCGCCACCTCACCACGCCGACCTGGAACGGCACCCTGCTC
GGCGACGCCGACAAGCCGGAAGCCCTCAGGTACGACACCGCCGCGCTGGACGACCTGGGC
GCCAAGCTGCTCGGGCTCACCTCGTGGGACGGGAGAAACATCAACCAAGGCGACCGAAGC
GGCGGGGAAGTAGCGTGCGACGCATCTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008775 Phytanoyl-CoA dioxygenase (Family)
 [44-259]  8.3e-10 PF05721
PF05721   PhyH
SignalP No significant hit
TMHMM No significant hit